Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L1IUW6

Protein Details
Accession A0A0L1IUW6    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
20-41RLSPHHLPRRHRRLAPNRPTPLBasic
NLS Segment(s)
PositionSequence
25-37HLPRRHRRLAPNR
68-85RGEEKVHRKRTSRIRQRR
Subcellular Location(s) mito_nucl 13.166, nucl 13, mito 13
Family & Domain DBs
Amino Acid Sequences LLGILPSPHLPHLPGPLLRRLSPHHLPRRHRRLAPNRPTPLQILHHRRHPHHRSLLPAQLEYLPRNERGEEKVHRKRTSRIRQRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.29
3 0.35
4 0.37
5 0.36
6 0.37
7 0.36
8 0.39
9 0.43
10 0.5
11 0.53
12 0.58
13 0.66
14 0.74
15 0.79
16 0.79
17 0.77
18 0.77
19 0.78
20 0.81
21 0.83
22 0.82
23 0.76
24 0.7
25 0.65
26 0.56
27 0.48
28 0.43
29 0.41
30 0.4
31 0.38
32 0.43
33 0.47
34 0.49
35 0.56
36 0.57
37 0.57
38 0.57
39 0.57
40 0.57
41 0.57
42 0.6
43 0.51
44 0.45
45 0.37
46 0.32
47 0.32
48 0.26
49 0.26
50 0.22
51 0.22
52 0.24
53 0.24
54 0.24
55 0.25
56 0.32
57 0.36
58 0.45
59 0.53
60 0.61
61 0.66
62 0.68
63 0.73
64 0.77
65 0.79