Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7E532

Protein Details
Accession A7E532   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
107-129NDVKWGGKARKKQRQTIRKILDQHydrophilic
NLS Segment(s)
PositionSequence
114-119KARKKQ
Subcellular Location(s) nucl 14, cyto_nucl 12.5, cyto 9, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR011431  Trafficking_Pga2  
Gene Ontology GO:0015031  P:protein transport  
KEGG ssl:SS1G_00404  -  
Pfam View protein in Pfam  
PF07543  PGA2  
Amino Acid Sequences MAEFITNLLEMGATNFYRNSTGAFEQLKTMELQKWIRIVAVVGAYLLIRPYFINLGAKKQEQEYAKARAQHAEKKEKEKHVGANSFRDSVKIPEDTDSEEDVKANSNDVKWGGKARKKQRQTIRKILDQEEKLRRQQQEDDEDKDIQEFLQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.12
4 0.14
5 0.14
6 0.14
7 0.15
8 0.17
9 0.21
10 0.23
11 0.23
12 0.23
13 0.23
14 0.22
15 0.19
16 0.2
17 0.17
18 0.21
19 0.22
20 0.23
21 0.24
22 0.23
23 0.22
24 0.2
25 0.17
26 0.13
27 0.12
28 0.09
29 0.07
30 0.07
31 0.07
32 0.06
33 0.06
34 0.04
35 0.04
36 0.04
37 0.06
38 0.06
39 0.07
40 0.13
41 0.14
42 0.19
43 0.22
44 0.23
45 0.23
46 0.23
47 0.27
48 0.22
49 0.27
50 0.27
51 0.29
52 0.31
53 0.34
54 0.33
55 0.33
56 0.35
57 0.36
58 0.39
59 0.42
60 0.43
61 0.48
62 0.54
63 0.53
64 0.54
65 0.51
66 0.5
67 0.48
68 0.51
69 0.44
70 0.44
71 0.41
72 0.39
73 0.36
74 0.31
75 0.25
76 0.2
77 0.21
78 0.16
79 0.15
80 0.15
81 0.16
82 0.18
83 0.19
84 0.19
85 0.17
86 0.16
87 0.15
88 0.13
89 0.15
90 0.13
91 0.13
92 0.12
93 0.11
94 0.13
95 0.14
96 0.16
97 0.14
98 0.22
99 0.28
100 0.34
101 0.43
102 0.52
103 0.61
104 0.67
105 0.75
106 0.78
107 0.81
108 0.83
109 0.85
110 0.82
111 0.79
112 0.78
113 0.75
114 0.73
115 0.67
116 0.67
117 0.66
118 0.64
119 0.64
120 0.65
121 0.62
122 0.58
123 0.6
124 0.6
125 0.6
126 0.6
127 0.59
128 0.56
129 0.53
130 0.48
131 0.42