Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L1J5I1

Protein Details
Accession A0A0L1J5I1   
Localization Confidence Low
Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
142-161GSHYRRKRTRFPAVDNDERTHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 9, nucl 8, cysk 7, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR039383  FHIT  
IPR011146  HIT-like  
IPR036265  HIT-like_sf  
Gene Ontology GO:0047710  F:bis(5'-adenosyl)-triphosphatase activity  
GO:0000166  F:nucleotide binding  
Pfam View protein in Pfam  
PF01230  HIT  
PROSITE View protein in PROSITE  
PS51084  HIT_2  
CDD cd01275  FHIT  
Amino Acid Sequences MPIEDSPSTMALAIKGPIHFGPFVVTPQVFHITPLSFALVNLKPILPGHVLVSPRRVVPRVSDLTPSETTDLFLTVRRVGRMVERVYGASSLNIAVQDGVEAGQSVPHVHAHIIPRKKADLDARGGTDAVYDMLDGEEGDLGSHYRRKRTRFPAVDNDERTPRSMEEMQAEASMLAKEMEAEEVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.15
4 0.15
5 0.17
6 0.16
7 0.14
8 0.16
9 0.15
10 0.16
11 0.17
12 0.17
13 0.15
14 0.18
15 0.22
16 0.19
17 0.19
18 0.2
19 0.17
20 0.18
21 0.18
22 0.16
23 0.12
24 0.12
25 0.17
26 0.15
27 0.16
28 0.16
29 0.15
30 0.14
31 0.14
32 0.17
33 0.12
34 0.12
35 0.12
36 0.15
37 0.17
38 0.17
39 0.21
40 0.19
41 0.2
42 0.22
43 0.22
44 0.19
45 0.21
46 0.28
47 0.29
48 0.29
49 0.3
50 0.29
51 0.33
52 0.33
53 0.3
54 0.23
55 0.19
56 0.18
57 0.15
58 0.14
59 0.09
60 0.1
61 0.1
62 0.12
63 0.13
64 0.13
65 0.13
66 0.13
67 0.16
68 0.2
69 0.19
70 0.18
71 0.17
72 0.17
73 0.17
74 0.17
75 0.14
76 0.09
77 0.08
78 0.06
79 0.06
80 0.05
81 0.05
82 0.04
83 0.04
84 0.03
85 0.03
86 0.03
87 0.03
88 0.03
89 0.03
90 0.04
91 0.04
92 0.04
93 0.05
94 0.05
95 0.06
96 0.06
97 0.1
98 0.14
99 0.21
100 0.26
101 0.27
102 0.29
103 0.3
104 0.3
105 0.31
106 0.32
107 0.3
108 0.31
109 0.31
110 0.31
111 0.3
112 0.29
113 0.25
114 0.18
115 0.14
116 0.09
117 0.06
118 0.05
119 0.04
120 0.04
121 0.04
122 0.04
123 0.04
124 0.04
125 0.04
126 0.04
127 0.04
128 0.05
129 0.07
130 0.13
131 0.15
132 0.24
133 0.3
134 0.37
135 0.47
136 0.56
137 0.65
138 0.69
139 0.75
140 0.76
141 0.79
142 0.81
143 0.76
144 0.71
145 0.65
146 0.58
147 0.51
148 0.43
149 0.35
150 0.33
151 0.31
152 0.29
153 0.27
154 0.28
155 0.27
156 0.25
157 0.25
158 0.18
159 0.16
160 0.13
161 0.09
162 0.08
163 0.06
164 0.06
165 0.07