Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A7ENV0

Protein Details
Accession A7ENV0    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
2-28AKSKNSSQHNQSKKAHRNGIKKPKTSRHydrophilic
NLS Segment(s)
PositionSequence
14-62KKAHRNGIKKPKTSRYPSLKGTDPKFRRNHRHALHGTMKALKELKEGKR
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0002181  P:cytoplasmic translation  
KEGG ssl:SS1G_06999  -  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNSSQHNQSKKAHRNGIKKPKTSRYPSLKGTDPKFRRNHRHALHGTMKALKELKEGKRESA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.8
3 0.8
4 0.79
5 0.8
6 0.82
7 0.85
8 0.83
9 0.8
10 0.79
11 0.79
12 0.79
13 0.76
14 0.75
15 0.73
16 0.7
17 0.67
18 0.64
19 0.6
20 0.57
21 0.54
22 0.55
23 0.5
24 0.53
25 0.56
26 0.61
27 0.65
28 0.66
29 0.72
30 0.66
31 0.71
32 0.65
33 0.66
34 0.64
35 0.57
36 0.54
37 0.48
38 0.45
39 0.39
40 0.39
41 0.31
42 0.31
43 0.36
44 0.4
45 0.45