Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L1IK46

Protein Details
Accession A0A0L1IK46    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
183-213QLATQEKENAKRKKRQALPQKKRRAPSATKVHydrophilic
NLS Segment(s)
PositionSequence
191-210NAKRKKRQALPQKKRRAPSA
Subcellular Location(s) nucl 14, mito 10, cyto 2
Family & Domain DBs
Amino Acid Sequences MKYTRSSAIPMFPLQAWSGNAASLRSSPSEASTNTDPVAFSFDTTWDGGSPISTPAAPPPTPQDSLLDITPRKCSFSTAFGMSNACAFPSWPNRPALISTDTEVSTGSAYISDEELCFDLTPQSESAVEEESAVQESVRPGDLTTEQQIQMLRAAAEEEAQRARFLAQVQAHARAQQAMRVAQLATQEKENAKRKKRQALPQKKRRAPSATKVVIRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.24
3 0.2
4 0.19
5 0.18
6 0.17
7 0.17
8 0.16
9 0.16
10 0.14
11 0.15
12 0.14
13 0.15
14 0.15
15 0.17
16 0.2
17 0.2
18 0.24
19 0.25
20 0.25
21 0.24
22 0.24
23 0.21
24 0.17
25 0.21
26 0.16
27 0.13
28 0.12
29 0.13
30 0.14
31 0.14
32 0.14
33 0.09
34 0.1
35 0.09
36 0.09
37 0.09
38 0.08
39 0.08
40 0.08
41 0.08
42 0.11
43 0.16
44 0.16
45 0.17
46 0.21
47 0.25
48 0.27
49 0.27
50 0.26
51 0.23
52 0.25
53 0.25
54 0.24
55 0.21
56 0.21
57 0.26
58 0.24
59 0.24
60 0.22
61 0.25
62 0.22
63 0.25
64 0.27
65 0.24
66 0.24
67 0.22
68 0.23
69 0.19
70 0.18
71 0.13
72 0.1
73 0.07
74 0.06
75 0.1
76 0.17
77 0.21
78 0.22
79 0.24
80 0.24
81 0.25
82 0.26
83 0.25
84 0.2
85 0.17
86 0.16
87 0.16
88 0.15
89 0.15
90 0.14
91 0.1
92 0.07
93 0.07
94 0.06
95 0.04
96 0.04
97 0.04
98 0.05
99 0.05
100 0.05
101 0.05
102 0.06
103 0.06
104 0.05
105 0.05
106 0.06
107 0.06
108 0.07
109 0.07
110 0.07
111 0.07
112 0.08
113 0.08
114 0.09
115 0.09
116 0.08
117 0.08
118 0.07
119 0.08
120 0.08
121 0.07
122 0.06
123 0.06
124 0.07
125 0.08
126 0.07
127 0.06
128 0.09
129 0.11
130 0.12
131 0.15
132 0.17
133 0.16
134 0.18
135 0.18
136 0.17
137 0.16
138 0.15
139 0.12
140 0.09
141 0.09
142 0.08
143 0.09
144 0.09
145 0.1
146 0.11
147 0.12
148 0.12
149 0.12
150 0.12
151 0.12
152 0.13
153 0.18
154 0.17
155 0.24
156 0.26
157 0.3
158 0.3
159 0.3
160 0.29
161 0.26
162 0.25
163 0.21
164 0.22
165 0.19
166 0.19
167 0.18
168 0.18
169 0.15
170 0.22
171 0.23
172 0.21
173 0.22
174 0.25
175 0.28
176 0.38
177 0.46
178 0.49
179 0.54
180 0.63
181 0.7
182 0.77
183 0.83
184 0.84
185 0.86
186 0.87
187 0.9
188 0.91
189 0.93
190 0.9
191 0.87
192 0.85
193 0.83
194 0.8
195 0.79
196 0.79
197 0.77