Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A7F4G4

Protein Details
Accession A7F4G4    Localization Confidence High Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MDKKRQSKKIIYKKNDVLNFHydrophilic
45-64GELAKRKKKHLPYARRKILSBasic
NLS Segment(s)
PositionSequence
49-60KRKKKHLPYARR
Subcellular Location(s) nucl 22, cyto_nucl 13.5, cyto 3
Family & Domain DBs
KEGG ssl:SS1G_12489  -  
Amino Acid Sequences MDKKRQSKKIIYKKNDVLNFGESGGGEERVWKFGEYGEYSDEGGGELAKRKKKHLPYARRKILSIQMRLIAILSLNSLSNLRSRRSPKEEKLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.77
3 0.69
4 0.61
5 0.53
6 0.46
7 0.36
8 0.29
9 0.2
10 0.17
11 0.15
12 0.13
13 0.1
14 0.13
15 0.13
16 0.14
17 0.15
18 0.13
19 0.12
20 0.12
21 0.17
22 0.15
23 0.15
24 0.15
25 0.15
26 0.15
27 0.15
28 0.13
29 0.09
30 0.07
31 0.06
32 0.05
33 0.09
34 0.14
35 0.19
36 0.2
37 0.23
38 0.31
39 0.39
40 0.5
41 0.55
42 0.62
43 0.69
44 0.79
45 0.85
46 0.79
47 0.72
48 0.65
49 0.63
50 0.6
51 0.52
52 0.44
53 0.37
54 0.35
55 0.34
56 0.3
57 0.21
58 0.13
59 0.1
60 0.08
61 0.06
62 0.06
63 0.07
64 0.07
65 0.08
66 0.13
67 0.17
68 0.19
69 0.27
70 0.33
71 0.43
72 0.52
73 0.61