Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7EBB9

Protein Details
Accession A7EBB9   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
30-49KRKSELASRKRRRSISLKRVBasic
NLS Segment(s)
PositionSequence
30-48KRKSELASRKRRRSISLKR
Subcellular Location(s) nucl 21, cyto_nucl 13, mito 3, cyto 3
Family & Domain DBs
KEGG ssl:SS1G_02605  -  
Amino Acid Sequences MSKIPRSNDPYVNNQNAMPKPIDPESDEGKRKSELASRKRRRSISLKRVGSIIPKCPSPKMLPFKDAFKHFPKGWWKCTYAHCPVGAHSIGERICPEMRSPGEVFADGQVEGERDPIDKKEGWWCCTVEGCIIRSAFTTLELCCKCPGSLGRDQAIRSCEEERPKSSSAYNIKCVMAEMKQMAEESSEEEIDEMEGGLEEEEEYFIEPEDSSKPKKLLLLKLPFQLGEIVLADKLSSSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.54
3 0.48
4 0.47
5 0.39
6 0.31
7 0.31
8 0.32
9 0.33
10 0.27
11 0.29
12 0.32
13 0.39
14 0.44
15 0.4
16 0.4
17 0.39
18 0.38
19 0.37
20 0.38
21 0.39
22 0.44
23 0.54
24 0.62
25 0.71
26 0.78
27 0.79
28 0.79
29 0.79
30 0.8
31 0.8
32 0.8
33 0.73
34 0.66
35 0.64
36 0.57
37 0.55
38 0.48
39 0.44
40 0.36
41 0.37
42 0.38
43 0.37
44 0.4
45 0.37
46 0.42
47 0.44
48 0.46
49 0.47
50 0.47
51 0.51
52 0.53
53 0.52
54 0.48
55 0.44
56 0.46
57 0.41
58 0.46
59 0.51
60 0.51
61 0.53
62 0.53
63 0.5
64 0.49
65 0.55
66 0.55
67 0.51
68 0.48
69 0.42
70 0.37
71 0.35
72 0.35
73 0.29
74 0.21
75 0.15
76 0.16
77 0.15
78 0.15
79 0.14
80 0.12
81 0.13
82 0.13
83 0.13
84 0.15
85 0.15
86 0.18
87 0.18
88 0.18
89 0.18
90 0.17
91 0.17
92 0.12
93 0.13
94 0.09
95 0.08
96 0.06
97 0.06
98 0.06
99 0.06
100 0.05
101 0.05
102 0.06
103 0.07
104 0.1
105 0.1
106 0.11
107 0.18
108 0.22
109 0.23
110 0.25
111 0.25
112 0.22
113 0.23
114 0.22
115 0.17
116 0.15
117 0.14
118 0.14
119 0.14
120 0.13
121 0.13
122 0.13
123 0.1
124 0.1
125 0.1
126 0.08
127 0.15
128 0.16
129 0.16
130 0.16
131 0.17
132 0.16
133 0.18
134 0.21
135 0.19
136 0.26
137 0.28
138 0.31
139 0.32
140 0.33
141 0.33
142 0.32
143 0.27
144 0.23
145 0.22
146 0.23
147 0.27
148 0.31
149 0.31
150 0.35
151 0.35
152 0.34
153 0.32
154 0.36
155 0.38
156 0.39
157 0.41
158 0.38
159 0.37
160 0.35
161 0.35
162 0.29
163 0.21
164 0.2
165 0.16
166 0.14
167 0.14
168 0.14
169 0.13
170 0.12
171 0.11
172 0.11
173 0.11
174 0.11
175 0.1
176 0.1
177 0.1
178 0.09
179 0.08
180 0.06
181 0.04
182 0.04
183 0.04
184 0.04
185 0.04
186 0.04
187 0.04
188 0.05
189 0.05
190 0.06
191 0.06
192 0.06
193 0.07
194 0.07
195 0.08
196 0.13
197 0.18
198 0.21
199 0.26
200 0.27
201 0.29
202 0.35
203 0.41
204 0.46
205 0.51
206 0.57
207 0.57
208 0.6
209 0.6
210 0.54
211 0.47
212 0.39
213 0.29
214 0.21
215 0.17
216 0.13
217 0.11
218 0.11
219 0.1