Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7E9B5

Protein Details
Accession A7E9B5   
Localization Confidence High
Confidence Score 17.5
NoLS Segment(s)
PositionSequenceProtein Nature
10-29EDTTSRSTTKKPRHGFKVGPHydrophilic
170-192EFERKEREKKAKIEERERFRRQMBasic
NLS Segment(s)
PositionSequence
38-65RRKVIAIKKDLIHKAKVKKAYAKLKAKE
134-208DKRRERGEKRGTKPAYFAKELAFAEKQKAEQMAKRAEFERKEREKKAKIEERERFRRQMAKARSGGKNGQRKLGR
Subcellular Location(s) nucl 22.5, cyto_nucl 14, cyto 4.5
Family & Domain DBs
KEGG ssl:SS1G_01895  -  
Amino Acid Sequences MAPSKRPREEDTTSRSTTKKPRHGFKVGPDNLPDGTWRRKVIAIKKDLIHKAKVKKAYAKLKAKEPVKEDRNLYVENKEKEDELERNEEGEDLAEGEEAVELHPQRKAMLDEPEADTAAKSVPRYSSNSEDVKDKRRERGEKRGTKPAYFAKELAFAEKQKAEQMAKRAEFERKEREKKAKIEERERFRRQMAKARSGGKNGQRKLGRESQVLLEKVKKVVGN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.56
3 0.56
4 0.58
5 0.6
6 0.62
7 0.64
8 0.7
9 0.75
10 0.81
11 0.8
12 0.79
13 0.8
14 0.74
15 0.69
16 0.61
17 0.54
18 0.46
19 0.4
20 0.33
21 0.27
22 0.29
23 0.3
24 0.29
25 0.29
26 0.33
27 0.4
28 0.47
29 0.51
30 0.51
31 0.52
32 0.54
33 0.6
34 0.63
35 0.6
36 0.57
37 0.55
38 0.57
39 0.59
40 0.62
41 0.59
42 0.6
43 0.65
44 0.69
45 0.71
46 0.73
47 0.69
48 0.7
49 0.73
50 0.69
51 0.65
52 0.59
53 0.59
54 0.54
55 0.55
56 0.49
57 0.46
58 0.45
59 0.42
60 0.39
61 0.36
62 0.38
63 0.35
64 0.35
65 0.31
66 0.27
67 0.27
68 0.29
69 0.25
70 0.21
71 0.24
72 0.21
73 0.21
74 0.21
75 0.19
76 0.15
77 0.12
78 0.09
79 0.05
80 0.05
81 0.04
82 0.04
83 0.04
84 0.04
85 0.04
86 0.04
87 0.05
88 0.05
89 0.06
90 0.07
91 0.07
92 0.08
93 0.09
94 0.11
95 0.12
96 0.16
97 0.17
98 0.18
99 0.19
100 0.2
101 0.18
102 0.17
103 0.13
104 0.09
105 0.09
106 0.08
107 0.07
108 0.07
109 0.09
110 0.12
111 0.15
112 0.19
113 0.23
114 0.27
115 0.29
116 0.29
117 0.33
118 0.34
119 0.39
120 0.44
121 0.42
122 0.45
123 0.52
124 0.6
125 0.61
126 0.69
127 0.71
128 0.73
129 0.75
130 0.78
131 0.72
132 0.63
133 0.61
134 0.57
135 0.52
136 0.44
137 0.4
138 0.31
139 0.33
140 0.32
141 0.31
142 0.27
143 0.22
144 0.23
145 0.24
146 0.23
147 0.2
148 0.24
149 0.23
150 0.24
151 0.3
152 0.35
153 0.35
154 0.37
155 0.38
156 0.41
157 0.43
158 0.46
159 0.5
160 0.51
161 0.58
162 0.63
163 0.71
164 0.72
165 0.74
166 0.79
167 0.77
168 0.77
169 0.79
170 0.8
171 0.81
172 0.83
173 0.82
174 0.76
175 0.72
176 0.7
177 0.66
178 0.67
179 0.65
180 0.64
181 0.64
182 0.68
183 0.67
184 0.65
185 0.67
186 0.66
187 0.67
188 0.6
189 0.63
190 0.61
191 0.59
192 0.61
193 0.62
194 0.59
195 0.52
196 0.52
197 0.51
198 0.53
199 0.52
200 0.48
201 0.44
202 0.41
203 0.4