Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0K8LFD2

Protein Details
Accession A0A0K8LFD2    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
188-220IRGLSRADRKERIRRNERKMRSNERRSRKSGGGBasic
NLS Segment(s)
PositionSequence
101-140KPLPTPKPPTKWELFARKKGIGKYSSKPGAALADKERRKK
182-220AAKGSSIRGLSRADRKERIRRNERKMRSNERRSRKSGGG
Subcellular Location(s) nucl 18.5, cyto_nucl 12, cyto 4.5, mito 4
Family & Domain DBs
Amino Acid Sequences MTEVEMATAASEAKPKPERLPVTVTKHTPYTFDLGYLMANDPNPLELSRSEPLNVSLKSIARDGTQSLLNQLLTTCPITSSAQNGVLLTLPPPATVLPRHKPLPTPKPPTKWELFARKKGIGKYSSKPGAALADKERRKKLVYDEEKGEWVPRWGYKGKNKSDDEWLVEVKEKDWKKEEEAAAKGSSIRGLSRADRKERIRRNERKMRSNERRSRKSGGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.28
3 0.33
4 0.42
5 0.45
6 0.45
7 0.53
8 0.54
9 0.58
10 0.62
11 0.6
12 0.54
13 0.54
14 0.5
15 0.44
16 0.37
17 0.33
18 0.26
19 0.24
20 0.21
21 0.17
22 0.16
23 0.15
24 0.14
25 0.1
26 0.1
27 0.1
28 0.1
29 0.1
30 0.11
31 0.1
32 0.11
33 0.1
34 0.15
35 0.17
36 0.18
37 0.17
38 0.17
39 0.2
40 0.24
41 0.23
42 0.21
43 0.22
44 0.22
45 0.23
46 0.23
47 0.21
48 0.15
49 0.16
50 0.15
51 0.14
52 0.15
53 0.13
54 0.14
55 0.14
56 0.14
57 0.12
58 0.11
59 0.1
60 0.09
61 0.1
62 0.08
63 0.07
64 0.09
65 0.11
66 0.11
67 0.13
68 0.14
69 0.15
70 0.15
71 0.14
72 0.13
73 0.12
74 0.11
75 0.09
76 0.09
77 0.07
78 0.07
79 0.07
80 0.07
81 0.08
82 0.13
83 0.19
84 0.21
85 0.26
86 0.28
87 0.28
88 0.34
89 0.41
90 0.47
91 0.5
92 0.55
93 0.56
94 0.61
95 0.62
96 0.62
97 0.56
98 0.51
99 0.48
100 0.5
101 0.5
102 0.51
103 0.52
104 0.51
105 0.52
106 0.49
107 0.48
108 0.42
109 0.41
110 0.38
111 0.42
112 0.41
113 0.38
114 0.36
115 0.31
116 0.3
117 0.26
118 0.25
119 0.23
120 0.29
121 0.33
122 0.39
123 0.4
124 0.38
125 0.39
126 0.39
127 0.42
128 0.44
129 0.47
130 0.46
131 0.48
132 0.47
133 0.47
134 0.44
135 0.37
136 0.26
137 0.21
138 0.18
139 0.15
140 0.18
141 0.21
142 0.28
143 0.36
144 0.45
145 0.51
146 0.58
147 0.59
148 0.57
149 0.62
150 0.58
151 0.53
152 0.47
153 0.4
154 0.32
155 0.33
156 0.3
157 0.23
158 0.28
159 0.25
160 0.27
161 0.31
162 0.33
163 0.34
164 0.42
165 0.46
166 0.45
167 0.46
168 0.45
169 0.4
170 0.37
171 0.33
172 0.25
173 0.22
174 0.16
175 0.13
176 0.13
177 0.16
178 0.22
179 0.3
180 0.38
181 0.43
182 0.51
183 0.59
184 0.67
185 0.73
186 0.78
187 0.8
188 0.82
189 0.86
190 0.88
191 0.89
192 0.89
193 0.89
194 0.9
195 0.9
196 0.91
197 0.9
198 0.9
199 0.9
200 0.86