Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0K8LH77

Protein Details
Accession A0A0K8LH77    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
14-39WKIPWRISSPQKARQRKRLRAVDRVVHydrophilic
78-99FDKKEKTYRKGIHKLPKWTRVSBasic
NLS Segment(s)
Subcellular Location(s) mito 23, mito_nucl 13.333, cyto_mito 12.333
Family & Domain DBs
Amino Acid Sequences MFKASSPLFSGLLWKIPWRISSPQKARQRKRLRAVDRVVDTLSAALRRNGQSTKAVDRWYAEMPREEEMLPKDKYTLFDKKEKTYRKGIHKLPKWTRVSQRLNPPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.22
4 0.25
5 0.25
6 0.32
7 0.36
8 0.46
9 0.52
10 0.59
11 0.67
12 0.76
13 0.79
14 0.83
15 0.85
16 0.84
17 0.86
18 0.87
19 0.83
20 0.82
21 0.79
22 0.76
23 0.67
24 0.59
25 0.49
26 0.38
27 0.31
28 0.22
29 0.18
30 0.12
31 0.1
32 0.09
33 0.12
34 0.13
35 0.15
36 0.16
37 0.17
38 0.19
39 0.21
40 0.25
41 0.25
42 0.25
43 0.23
44 0.23
45 0.24
46 0.23
47 0.22
48 0.19
49 0.19
50 0.19
51 0.2
52 0.2
53 0.18
54 0.17
55 0.18
56 0.23
57 0.2
58 0.19
59 0.19
60 0.19
61 0.22
62 0.26
63 0.32
64 0.3
65 0.38
66 0.42
67 0.49
68 0.57
69 0.62
70 0.61
71 0.63
72 0.67
73 0.69
74 0.74
75 0.76
76 0.77
77 0.77
78 0.83
79 0.82
80 0.84
81 0.79
82 0.78
83 0.79
84 0.79
85 0.8
86 0.77
87 0.79