Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0K8LJY1

Protein Details
Accession A0A0K8LJY1    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
14-40GRNNPGINSPPKRKPPKLRRNFPPVVEHydrophilic
NLS Segment(s)
PositionSequence
23-33PPKRKPPKLRR
Subcellular Location(s) nucl 20, cyto_nucl 14.5, cyto 5
Family & Domain DBs
Amino Acid Sequences MAESMEKAPSTYAGRNNPGINSPPKRKPPKLRRNFPPVVEPSEKDAESTKDPDSRQVSRDTNGDVTSTSHESTVDEEYVREQESATTETEPRGGGQTAHQPSAKQTAVIDRPETAPVENWQRRVRGRRGTQQLVPIGDITDVGKTANRAVGTVHDVGSKAISSAGNTAGRALGEVVGVSQGEQKGKEEQLRLRLDLNLDIEVQLKAKIHGDLTLQLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.43
3 0.45
4 0.43
5 0.42
6 0.42
7 0.44
8 0.46
9 0.5
10 0.55
11 0.63
12 0.72
13 0.78
14 0.83
15 0.85
16 0.88
17 0.9
18 0.92
19 0.91
20 0.91
21 0.87
22 0.79
23 0.77
24 0.7
25 0.66
26 0.6
27 0.52
28 0.47
29 0.45
30 0.42
31 0.34
32 0.32
33 0.27
34 0.27
35 0.29
36 0.26
37 0.27
38 0.27
39 0.34
40 0.37
41 0.37
42 0.36
43 0.4
44 0.39
45 0.36
46 0.38
47 0.33
48 0.3
49 0.27
50 0.24
51 0.18
52 0.16
53 0.17
54 0.17
55 0.15
56 0.13
57 0.12
58 0.12
59 0.14
60 0.14
61 0.12
62 0.1
63 0.1
64 0.11
65 0.12
66 0.13
67 0.1
68 0.08
69 0.08
70 0.1
71 0.12
72 0.12
73 0.12
74 0.11
75 0.12
76 0.13
77 0.12
78 0.1
79 0.1
80 0.09
81 0.08
82 0.1
83 0.18
84 0.19
85 0.21
86 0.21
87 0.19
88 0.2
89 0.26
90 0.24
91 0.16
92 0.14
93 0.18
94 0.21
95 0.22
96 0.21
97 0.16
98 0.17
99 0.18
100 0.18
101 0.13
102 0.1
103 0.12
104 0.21
105 0.23
106 0.26
107 0.28
108 0.31
109 0.36
110 0.43
111 0.47
112 0.47
113 0.51
114 0.56
115 0.62
116 0.63
117 0.6
118 0.58
119 0.53
120 0.44
121 0.38
122 0.29
123 0.21
124 0.16
125 0.14
126 0.09
127 0.06
128 0.06
129 0.05
130 0.06
131 0.06
132 0.07
133 0.1
134 0.09
135 0.09
136 0.09
137 0.12
138 0.14
139 0.15
140 0.15
141 0.13
142 0.13
143 0.13
144 0.13
145 0.11
146 0.07
147 0.08
148 0.08
149 0.08
150 0.09
151 0.13
152 0.14
153 0.14
154 0.14
155 0.13
156 0.12
157 0.12
158 0.11
159 0.07
160 0.06
161 0.06
162 0.05
163 0.05
164 0.05
165 0.05
166 0.08
167 0.1
168 0.12
169 0.13
170 0.15
171 0.19
172 0.24
173 0.29
174 0.31
175 0.35
176 0.42
177 0.46
178 0.46
179 0.43
180 0.41
181 0.37
182 0.35
183 0.32
184 0.24
185 0.2
186 0.19
187 0.18
188 0.17
189 0.15
190 0.14
191 0.12
192 0.13
193 0.15
194 0.16
195 0.15
196 0.17
197 0.19