Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0K8KZN2

Protein Details
Accession A0A0K8KZN2   
Localization Confidence Medium
Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MTNSKMDKVKANRKRKVKINFISWKRHydrophilic
NLS Segment(s)
PositionSequence
10-18KANRKRKVK
Subcellular Location(s) nucl 21.5, mito_nucl 13.166, cyto_nucl 12.833, mito 3.5
Family & Domain DBs
Amino Acid Sequences MTNSKMDKVKANRKRKVKINFISWKREFERAAKANDTSKYLTSEEVVPPKPRKEYYFAKPGDAEIRRSSQTKKISTPNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.84
3 0.84
4 0.84
5 0.81
6 0.81
7 0.82
8 0.78
9 0.79
10 0.71
11 0.68
12 0.6
13 0.57
14 0.49
15 0.42
16 0.46
17 0.4
18 0.42
19 0.37
20 0.36
21 0.35
22 0.35
23 0.34
24 0.25
25 0.22
26 0.21
27 0.19
28 0.18
29 0.15
30 0.16
31 0.16
32 0.19
33 0.2
34 0.24
35 0.27
36 0.29
37 0.33
38 0.34
39 0.34
40 0.37
41 0.42
42 0.43
43 0.49
44 0.47
45 0.46
46 0.43
47 0.42
48 0.44
49 0.39
50 0.36
51 0.3
52 0.34
53 0.34
54 0.36
55 0.38
56 0.38
57 0.44
58 0.46
59 0.5