Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0K8L2J6

Protein Details
Accession A0A0K8L2J6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
12-32IENVTTKSRNKNQPLPKKYSLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 27
Family & Domain DBs
Amino Acid Sequences MSSRATPLLRLIENVTTKSRNKNQPLPKKYSLQIACHVKPNASSSREGIMAVGAEKVDVCVAAVPRNGEANAAVSRVFAQIFDVPKSNAEVIRGLKSRDKTLSITDLDIGKDGEEQFLERARQRLEEAIINYN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.32
3 0.32
4 0.35
5 0.43
6 0.49
7 0.52
8 0.58
9 0.65
10 0.71
11 0.77
12 0.82
13 0.81
14 0.77
15 0.73
16 0.67
17 0.67
18 0.61
19 0.54
20 0.54
21 0.54
22 0.5
23 0.52
24 0.5
25 0.41
26 0.38
27 0.38
28 0.36
29 0.3
30 0.3
31 0.24
32 0.25
33 0.25
34 0.23
35 0.19
36 0.12
37 0.1
38 0.08
39 0.07
40 0.05
41 0.04
42 0.04
43 0.04
44 0.04
45 0.03
46 0.03
47 0.04
48 0.05
49 0.07
50 0.08
51 0.08
52 0.08
53 0.09
54 0.09
55 0.08
56 0.08
57 0.08
58 0.08
59 0.08
60 0.07
61 0.07
62 0.08
63 0.08
64 0.08
65 0.05
66 0.07
67 0.1
68 0.11
69 0.13
70 0.13
71 0.13
72 0.14
73 0.16
74 0.15
75 0.13
76 0.12
77 0.15
78 0.16
79 0.21
80 0.23
81 0.23
82 0.27
83 0.29
84 0.32
85 0.32
86 0.33
87 0.29
88 0.31
89 0.34
90 0.3
91 0.29
92 0.26
93 0.25
94 0.22
95 0.21
96 0.17
97 0.12
98 0.13
99 0.12
100 0.11
101 0.1
102 0.11
103 0.12
104 0.16
105 0.2
106 0.2
107 0.25
108 0.25
109 0.28
110 0.29
111 0.31
112 0.31
113 0.33