Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A7F9B2

Protein Details
Accession A7F9B2    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
51-73IEPRGWRGERLKPRRNKEDCERKBasic
NLS Segment(s)
PositionSequence
58-65GERLKPRR
Subcellular Location(s) cyto_nucl 14, nucl 13.5, cyto 13.5
Family & Domain DBs
KEGG ssl:SS1G_14193  -  
Amino Acid Sequences MILPFYEELAQMAEKDQNGKWDEKLEVFLKVYQLDMFFVVDMSDTVEKIQIEPRGWRGERLKPRRNKEDCERK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.15
3 0.15
4 0.2
5 0.22
6 0.24
7 0.24
8 0.24
9 0.25
10 0.23
11 0.26
12 0.21
13 0.2
14 0.19
15 0.19
16 0.17
17 0.15
18 0.15
19 0.11
20 0.1
21 0.09
22 0.08
23 0.07
24 0.06
25 0.05
26 0.05
27 0.04
28 0.04
29 0.06
30 0.05
31 0.05
32 0.06
33 0.08
34 0.08
35 0.09
36 0.13
37 0.15
38 0.16
39 0.19
40 0.24
41 0.31
42 0.31
43 0.37
44 0.39
45 0.45
46 0.55
47 0.62
48 0.68
49 0.69
50 0.78
51 0.82
52 0.84
53 0.83