Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0K8L6T7

Protein Details
Accession A0A0K8L6T7   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
145-181GGDPPRAKPKPANKPRRRKRPDKGKKKAAMAKKREEEBasic
NLS Segment(s)
PositionSequence
148-186PPRAKPKPANKPRRRKRPDKGKKKAAMAKKREEEEKKKE
Subcellular Location(s) nucl 16, mito 7, cyto 3
Family & Domain DBs
Amino Acid Sequences MRGSNDYLMSRSISLSSPPIADLWIDINRTNETPAAPAAPAAPAPPADPANKKSPLIQFNLPEKQLQKGNTNMDIERRCPRCGNSHTGQCRPYCHSCGFRHAGKCHPPAMPANTTTSQEGPAVVWNGGVHITVNAAAPPRSTSAGGDPPRAKPKPANKPRRRKRPDKGKKKAAMAKKREEEEKKKEEEEAEKGAEKQGEAEGDKPSSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.17
4 0.16
5 0.16
6 0.15
7 0.14
8 0.13
9 0.12
10 0.13
11 0.14
12 0.15
13 0.16
14 0.18
15 0.2
16 0.21
17 0.21
18 0.19
19 0.16
20 0.16
21 0.16
22 0.15
23 0.12
24 0.12
25 0.11
26 0.1
27 0.1
28 0.09
29 0.09
30 0.08
31 0.08
32 0.11
33 0.13
34 0.16
35 0.2
36 0.24
37 0.3
38 0.33
39 0.33
40 0.35
41 0.4
42 0.41
43 0.41
44 0.42
45 0.41
46 0.45
47 0.49
48 0.45
49 0.4
50 0.37
51 0.35
52 0.35
53 0.32
54 0.29
55 0.3
56 0.33
57 0.34
58 0.35
59 0.32
60 0.34
61 0.33
62 0.32
63 0.35
64 0.34
65 0.32
66 0.32
67 0.34
68 0.36
69 0.39
70 0.43
71 0.4
72 0.46
73 0.49
74 0.52
75 0.53
76 0.45
77 0.44
78 0.42
79 0.4
80 0.35
81 0.34
82 0.37
83 0.35
84 0.4
85 0.41
86 0.39
87 0.41
88 0.39
89 0.41
90 0.4
91 0.41
92 0.38
93 0.34
94 0.31
95 0.29
96 0.31
97 0.27
98 0.22
99 0.24
100 0.22
101 0.23
102 0.22
103 0.19
104 0.16
105 0.14
106 0.13
107 0.09
108 0.1
109 0.1
110 0.09
111 0.08
112 0.07
113 0.07
114 0.07
115 0.07
116 0.05
117 0.04
118 0.04
119 0.05
120 0.05
121 0.05
122 0.06
123 0.06
124 0.07
125 0.08
126 0.1
127 0.11
128 0.11
129 0.11
130 0.14
131 0.23
132 0.25
133 0.3
134 0.3
135 0.34
136 0.43
137 0.43
138 0.42
139 0.42
140 0.5
141 0.55
142 0.64
143 0.7
144 0.72
145 0.82
146 0.9
147 0.93
148 0.93
149 0.92
150 0.92
151 0.92
152 0.93
153 0.93
154 0.94
155 0.93
156 0.91
157 0.9
158 0.88
159 0.87
160 0.86
161 0.83
162 0.83
163 0.8
164 0.77
165 0.76
166 0.78
167 0.77
168 0.76
169 0.75
170 0.7
171 0.64
172 0.63
173 0.58
174 0.54
175 0.5
176 0.45
177 0.41
178 0.37
179 0.37
180 0.37
181 0.33
182 0.27
183 0.23
184 0.21
185 0.21
186 0.21
187 0.22
188 0.22