Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0K8LEH1

Protein Details
Accession A0A0K8LEH1   
Localization Confidence Low
Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
9-34CLRDASFRKYRRCQRLGKTCRKIPLQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11, mito 8, cyto 8, cyto_mito 8
Family & Domain DBs
Amino Acid Sequences MKNGDHCVCLRDASFRKYRRCQRLGKTCRKIPLQLRRRVACRKFDDELTAVTSFLRKQETPHLLRSLNRNVFRLLTVMSAVSGGRVPAPEEEVEFEMYEGEVADE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.47
3 0.55
4 0.63
5 0.73
6 0.74
7 0.77
8 0.79
9 0.81
10 0.85
11 0.86
12 0.87
13 0.86
14 0.81
15 0.8
16 0.75
17 0.71
18 0.7
19 0.7
20 0.69
21 0.68
22 0.71
23 0.67
24 0.71
25 0.73
26 0.68
27 0.67
28 0.63
29 0.6
30 0.54
31 0.51
32 0.47
33 0.38
34 0.33
35 0.27
36 0.21
37 0.15
38 0.13
39 0.12
40 0.1
41 0.1
42 0.12
43 0.09
44 0.11
45 0.2
46 0.28
47 0.3
48 0.34
49 0.36
50 0.35
51 0.37
52 0.42
53 0.43
54 0.43
55 0.42
56 0.39
57 0.37
58 0.36
59 0.34
60 0.29
61 0.2
62 0.13
63 0.11
64 0.1
65 0.08
66 0.08
67 0.07
68 0.07
69 0.06
70 0.06
71 0.06
72 0.07
73 0.08
74 0.09
75 0.11
76 0.11
77 0.12
78 0.15
79 0.16
80 0.17
81 0.16
82 0.15
83 0.12
84 0.12
85 0.11