Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A7ETB5

Protein Details
Accession A7ETB5    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
216-235EQGPKSKKSKGKTRASGELFHydrophilic
NLS Segment(s)
PositionSequence
220-227KSKKSKGK
Subcellular Location(s) nucl 16.5, cyto_nucl 13, cyto 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR025602  BCP1_family  
Gene Ontology GO:0005634  C:nucleus  
GO:0015031  P:protein transport  
KEGG ssl:SS1G_08570  -  
Pfam View protein in Pfam  
PF13862  BCCIP  
Amino Acid Sequences MVKKRVRDPEELPDAPVHSAGEENDSGSDGEDILNVDFEWFNFREIDFHGVKSLIRQLFDVDSQLLDLSDLADEVVKQGTIGSTVKVDGEGTDAYAFMTVLNLHRGNGEVDGDKGERDMEVGEAVRGLRGYLASQAKEGGLVQRVVNGGGKLGGDVGVVLAERLINVPAEVAPPMYGMLVDELEAAVEDGEPYDFAYYLVVSRGYREVESRLDREEQGPKSKKSKGKTRASGELFYFHPEDEVLKRFSCAYEEFEYKKDEGEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.38
3 0.33
4 0.23
5 0.14
6 0.15
7 0.13
8 0.15
9 0.13
10 0.13
11 0.13
12 0.13
13 0.13
14 0.12
15 0.12
16 0.08
17 0.08
18 0.07
19 0.08
20 0.07
21 0.08
22 0.07
23 0.08
24 0.08
25 0.08
26 0.13
27 0.12
28 0.13
29 0.13
30 0.14
31 0.14
32 0.16
33 0.22
34 0.18
35 0.18
36 0.18
37 0.18
38 0.18
39 0.19
40 0.25
41 0.21
42 0.2
43 0.2
44 0.2
45 0.22
46 0.22
47 0.21
48 0.14
49 0.12
50 0.12
51 0.11
52 0.09
53 0.07
54 0.06
55 0.05
56 0.04
57 0.04
58 0.04
59 0.04
60 0.04
61 0.05
62 0.05
63 0.04
64 0.04
65 0.05
66 0.05
67 0.07
68 0.08
69 0.07
70 0.07
71 0.08
72 0.08
73 0.08
74 0.08
75 0.06
76 0.08
77 0.07
78 0.07
79 0.07
80 0.07
81 0.06
82 0.06
83 0.06
84 0.04
85 0.04
86 0.04
87 0.05
88 0.09
89 0.09
90 0.09
91 0.1
92 0.11
93 0.11
94 0.11
95 0.11
96 0.08
97 0.08
98 0.09
99 0.09
100 0.09
101 0.08
102 0.07
103 0.06
104 0.06
105 0.06
106 0.04
107 0.05
108 0.05
109 0.05
110 0.05
111 0.05
112 0.05
113 0.05
114 0.04
115 0.04
116 0.04
117 0.04
118 0.09
119 0.11
120 0.11
121 0.12
122 0.12
123 0.12
124 0.12
125 0.12
126 0.08
127 0.08
128 0.09
129 0.08
130 0.1
131 0.1
132 0.1
133 0.11
134 0.09
135 0.08
136 0.07
137 0.07
138 0.05
139 0.05
140 0.05
141 0.04
142 0.03
143 0.03
144 0.03
145 0.03
146 0.03
147 0.03
148 0.02
149 0.03
150 0.03
151 0.04
152 0.04
153 0.04
154 0.04
155 0.05
156 0.05
157 0.05
158 0.05
159 0.05
160 0.05
161 0.05
162 0.05
163 0.05
164 0.04
165 0.05
166 0.05
167 0.05
168 0.04
169 0.04
170 0.04
171 0.04
172 0.04
173 0.03
174 0.03
175 0.03
176 0.03
177 0.03
178 0.04
179 0.04
180 0.04
181 0.05
182 0.05
183 0.05
184 0.05
185 0.06
186 0.07
187 0.08
188 0.08
189 0.1
190 0.12
191 0.13
192 0.14
193 0.16
194 0.18
195 0.23
196 0.28
197 0.28
198 0.28
199 0.3
200 0.3
201 0.33
202 0.38
203 0.36
204 0.42
205 0.47
206 0.49
207 0.53
208 0.61
209 0.63
210 0.64
211 0.7
212 0.7
213 0.74
214 0.78
215 0.79
216 0.8
217 0.78
218 0.74
219 0.65
220 0.58
221 0.48
222 0.42
223 0.36
224 0.25
225 0.21
226 0.17
227 0.18
228 0.19
229 0.22
230 0.21
231 0.21
232 0.22
233 0.22
234 0.23
235 0.23
236 0.21
237 0.23
238 0.26
239 0.32
240 0.34
241 0.35
242 0.39
243 0.35