Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0K8LKV4

Protein Details
Accession A0A0K8LKV4    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
90-109LKKLNKNKKLIKKLARKYDAHydrophilic
NLS Segment(s)
PositionSequence
94-103NKNKKLIKKL
Subcellular Location(s) nucl 12.5, cyto 10, mito_nucl 8, mito 2.5
Family & Domain DBs
Amino Acid Sequences MSKITVAGVRENIEQLLNYSQNEKKRNFLETVELQIGLKNYDPQRDKRFSGTIKLPTVPRPNMTICVLGDQHDLDRAKHHGIDAMSADDLKKLNKNKKLIKKLARKYDAFLASDTLIKQIPRLLGPGLSKAGKFPTPVSHNEDMANKVTEIKSTIKFQLKKVLCLGVAVGNVGMTQDELVANVMLAINYLVSLLKKGWQNVGSLVLKATMSPPKRLY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.16
3 0.19
4 0.19
5 0.18
6 0.22
7 0.26
8 0.33
9 0.41
10 0.4
11 0.42
12 0.44
13 0.47
14 0.45
15 0.42
16 0.43
17 0.38
18 0.42
19 0.36
20 0.33
21 0.28
22 0.27
23 0.25
24 0.18
25 0.16
26 0.17
27 0.18
28 0.26
29 0.31
30 0.37
31 0.45
32 0.5
33 0.51
34 0.5
35 0.55
36 0.49
37 0.52
38 0.51
39 0.49
40 0.47
41 0.47
42 0.44
43 0.44
44 0.49
45 0.45
46 0.39
47 0.36
48 0.35
49 0.35
50 0.35
51 0.3
52 0.22
53 0.23
54 0.21
55 0.19
56 0.18
57 0.15
58 0.13
59 0.16
60 0.17
61 0.14
62 0.16
63 0.17
64 0.18
65 0.18
66 0.17
67 0.16
68 0.15
69 0.16
70 0.14
71 0.13
72 0.11
73 0.11
74 0.11
75 0.08
76 0.09
77 0.09
78 0.13
79 0.2
80 0.28
81 0.34
82 0.43
83 0.51
84 0.6
85 0.69
86 0.73
87 0.76
88 0.78
89 0.79
90 0.81
91 0.78
92 0.69
93 0.61
94 0.58
95 0.51
96 0.41
97 0.34
98 0.25
99 0.19
100 0.2
101 0.17
102 0.11
103 0.1
104 0.09
105 0.09
106 0.1
107 0.1
108 0.09
109 0.11
110 0.1
111 0.12
112 0.13
113 0.14
114 0.14
115 0.14
116 0.14
117 0.13
118 0.16
119 0.14
120 0.15
121 0.14
122 0.19
123 0.22
124 0.26
125 0.33
126 0.32
127 0.32
128 0.33
129 0.33
130 0.28
131 0.27
132 0.24
133 0.17
134 0.17
135 0.16
136 0.15
137 0.16
138 0.18
139 0.18
140 0.21
141 0.27
142 0.33
143 0.36
144 0.37
145 0.45
146 0.43
147 0.43
148 0.42
149 0.39
150 0.3
151 0.28
152 0.27
153 0.19
154 0.17
155 0.14
156 0.11
157 0.08
158 0.08
159 0.07
160 0.06
161 0.04
162 0.04
163 0.04
164 0.04
165 0.05
166 0.06
167 0.05
168 0.05
169 0.05
170 0.06
171 0.05
172 0.05
173 0.05
174 0.04
175 0.04
176 0.04
177 0.05
178 0.05
179 0.07
180 0.07
181 0.12
182 0.16
183 0.19
184 0.25
185 0.26
186 0.27
187 0.28
188 0.35
189 0.32
190 0.28
191 0.27
192 0.22
193 0.2
194 0.19
195 0.21
196 0.22
197 0.24