Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A7EL99

Protein Details
Accession A7EL99    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
100-126FLSRIKTRKGRATLQRRKSKKRSTLSHHydrophilic
NLS Segment(s)
PositionSequence
94-122RKRRHGFLSRIKTRKGRATLQRRKSKKRS
Subcellular Location(s) mito 13.5, nucl 10, cyto_mito 8.666, cyto_nucl 7.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG ssl:SS1G_06096  -  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MLCLHCSHGLRVTPIVTRVLSQSSSMLVKRTFTSITPLRPTLSPGAFKPTSSVIIASEAAPLDLLPKISAHPALSTTQVRCGPRNTFSPSHFVRKRRHGFLSRIKTRKGRATLQRRKSKKRSTLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.27
3 0.22
4 0.2
5 0.19
6 0.2
7 0.19
8 0.17
9 0.16
10 0.15
11 0.18
12 0.18
13 0.19
14 0.17
15 0.18
16 0.18
17 0.2
18 0.19
19 0.16
20 0.23
21 0.24
22 0.29
23 0.31
24 0.32
25 0.31
26 0.3
27 0.32
28 0.29
29 0.28
30 0.25
31 0.21
32 0.27
33 0.26
34 0.25
35 0.24
36 0.21
37 0.2
38 0.18
39 0.17
40 0.1
41 0.11
42 0.12
43 0.1
44 0.09
45 0.08
46 0.07
47 0.06
48 0.06
49 0.05
50 0.05
51 0.05
52 0.04
53 0.05
54 0.05
55 0.06
56 0.07
57 0.07
58 0.07
59 0.09
60 0.09
61 0.13
62 0.15
63 0.15
64 0.19
65 0.23
66 0.24
67 0.25
68 0.28
69 0.28
70 0.29
71 0.34
72 0.35
73 0.35
74 0.35
75 0.4
76 0.4
77 0.47
78 0.49
79 0.51
80 0.53
81 0.6
82 0.66
83 0.66
84 0.71
85 0.68
86 0.71
87 0.75
88 0.77
89 0.77
90 0.75
91 0.74
92 0.72
93 0.71
94 0.71
95 0.67
96 0.66
97 0.66
98 0.72
99 0.77
100 0.81
101 0.85
102 0.86
103 0.9
104 0.91
105 0.91
106 0.9