Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0K8LCS3

Protein Details
Accession A0A0K8LCS3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
89-115YVEYVEKPSRSRRRREDIRRPAKVYLNHydrophilic
NLS Segment(s)
PositionSequence
96-109PSRSRRRREDIRRP
Subcellular Location(s) extr 11, plas 8, cyto 3, mito 2, E.R. 2
Family & Domain DBs
Amino Acid Sequences MAPVLSNILQARQSSSSSDNCNCPSSISGGGIAGIVIGTIAGTLLLIWLFRVCSLPGAFGGGEPDYGYSGGGGTEVRSTHRRRRSSPSYVEYVEKPSRSRRRREDIRRPAKVYLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.24
3 0.27
4 0.31
5 0.34
6 0.35
7 0.35
8 0.36
9 0.33
10 0.31
11 0.27
12 0.24
13 0.22
14 0.18
15 0.16
16 0.13
17 0.13
18 0.11
19 0.1
20 0.06
21 0.04
22 0.03
23 0.02
24 0.02
25 0.02
26 0.02
27 0.02
28 0.02
29 0.02
30 0.02
31 0.02
32 0.02
33 0.02
34 0.02
35 0.03
36 0.03
37 0.03
38 0.05
39 0.05
40 0.07
41 0.07
42 0.07
43 0.07
44 0.08
45 0.08
46 0.07
47 0.08
48 0.06
49 0.06
50 0.05
51 0.05
52 0.05
53 0.05
54 0.05
55 0.04
56 0.04
57 0.04
58 0.04
59 0.04
60 0.04
61 0.05
62 0.06
63 0.09
64 0.16
65 0.21
66 0.3
67 0.39
68 0.45
69 0.49
70 0.59
71 0.64
72 0.67
73 0.71
74 0.67
75 0.63
76 0.59
77 0.57
78 0.49
79 0.48
80 0.44
81 0.38
82 0.36
83 0.41
84 0.5
85 0.55
86 0.64
87 0.66
88 0.72
89 0.8
90 0.88
91 0.89
92 0.9
93 0.92
94 0.92
95 0.86