Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7F540

Protein Details
Accession A7F540   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
72-94NRPTLQFNKKRRRQPSHSEPHINHydrophilic
NLS Segment(s)
PositionSequence
81-83KRR
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
KEGG ssl:SS1G_12715  -  
Amino Acid Sequences MSEEISMTGTTQPSFTEVILGTPYQEGHLEQIHKGNNSLPFILSNPTPSQPFNFQAQRDILSFDDPFKSPINRPTLQFNKKRRRQPSHSEPHINSPKEAIRKARDLLILAASLKEDTEEQSKVLDLIEIFREYLKKGKLTKASNIIISQISHLENTI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.13
4 0.12
5 0.13
6 0.14
7 0.14
8 0.12
9 0.12
10 0.12
11 0.1
12 0.11
13 0.1
14 0.11
15 0.15
16 0.16
17 0.17
18 0.22
19 0.24
20 0.24
21 0.24
22 0.26
23 0.26
24 0.26
25 0.25
26 0.21
27 0.18
28 0.19
29 0.2
30 0.16
31 0.16
32 0.16
33 0.17
34 0.18
35 0.18
36 0.2
37 0.22
38 0.24
39 0.27
40 0.29
41 0.28
42 0.3
43 0.3
44 0.29
45 0.25
46 0.25
47 0.19
48 0.16
49 0.16
50 0.14
51 0.14
52 0.13
53 0.14
54 0.14
55 0.16
56 0.16
57 0.22
58 0.27
59 0.27
60 0.28
61 0.35
62 0.42
63 0.48
64 0.55
65 0.59
66 0.63
67 0.69
68 0.77
69 0.79
70 0.79
71 0.78
72 0.8
73 0.81
74 0.81
75 0.8
76 0.79
77 0.7
78 0.7
79 0.7
80 0.61
81 0.5
82 0.42
83 0.39
84 0.36
85 0.38
86 0.34
87 0.3
88 0.34
89 0.35
90 0.35
91 0.32
92 0.29
93 0.27
94 0.22
95 0.19
96 0.15
97 0.14
98 0.1
99 0.09
100 0.07
101 0.07
102 0.06
103 0.08
104 0.11
105 0.12
106 0.12
107 0.12
108 0.12
109 0.12
110 0.12
111 0.11
112 0.07
113 0.09
114 0.11
115 0.12
116 0.12
117 0.13
118 0.14
119 0.14
120 0.21
121 0.22
122 0.26
123 0.3
124 0.38
125 0.46
126 0.5
127 0.56
128 0.59
129 0.58
130 0.56
131 0.52
132 0.47
133 0.4
134 0.35
135 0.29
136 0.23
137 0.2