Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0K8L4S1

Protein Details
Accession A0A0K8L4S1    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
41-79SPTPADNRERRRLHRIRKKEYFLRKQKPKPLSAREKRISBasic
238-258QFENRPVDRANKKFKWRNVEYHydrophilic
NLS Segment(s)
PositionSequence
48-77RERRRLHRIRKKEYFLRKQKPKPLSAREKR
Subcellular Location(s) nucl 12.5cyto_nucl 12.5, cyto 11.5
Family & Domain DBs
Amino Acid Sequences MTAPKPHIARELLARAHSPDTAEQLFTERIKQKPLYLRPTSPTPADNRERRRLHRIRKKEYFLRKQKPKPLSAREKRISGLYDLPKEECKYSIFKELHKLWVDYMQEILDLRVRQVPITPQSHGSKLVTADFHGAELEVVRSRCSGRVGVKGIVVRDTKFTFMIVTEKDEVKSEFTFADLLRGWRTEPRANLRREAIPKEHTIFRFSVPLPSADDEDTAISDGDKVKKELTFELHGSQFENRPVDRANKKFKWRNVEYL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.35
3 0.35
4 0.33
5 0.27
6 0.22
7 0.24
8 0.24
9 0.23
10 0.2
11 0.22
12 0.24
13 0.23
14 0.29
15 0.29
16 0.3
17 0.36
18 0.38
19 0.41
20 0.48
21 0.56
22 0.58
23 0.58
24 0.61
25 0.59
26 0.64
27 0.6
28 0.53
29 0.48
30 0.44
31 0.46
32 0.5
33 0.54
34 0.56
35 0.62
36 0.67
37 0.7
38 0.75
39 0.77
40 0.79
41 0.81
42 0.83
43 0.84
44 0.86
45 0.88
46 0.87
47 0.88
48 0.87
49 0.88
50 0.88
51 0.88
52 0.87
53 0.88
54 0.86
55 0.84
56 0.82
57 0.82
58 0.82
59 0.81
60 0.83
61 0.78
62 0.73
63 0.65
64 0.58
65 0.49
66 0.41
67 0.39
68 0.34
69 0.33
70 0.32
71 0.32
72 0.32
73 0.32
74 0.3
75 0.23
76 0.2
77 0.2
78 0.21
79 0.29
80 0.27
81 0.27
82 0.35
83 0.35
84 0.4
85 0.38
86 0.36
87 0.27
88 0.31
89 0.3
90 0.22
91 0.21
92 0.14
93 0.12
94 0.12
95 0.11
96 0.09
97 0.09
98 0.09
99 0.11
100 0.12
101 0.11
102 0.12
103 0.16
104 0.18
105 0.21
106 0.21
107 0.22
108 0.24
109 0.25
110 0.26
111 0.22
112 0.18
113 0.16
114 0.17
115 0.13
116 0.11
117 0.12
118 0.1
119 0.1
120 0.08
121 0.07
122 0.05
123 0.05
124 0.06
125 0.07
126 0.07
127 0.07
128 0.08
129 0.09
130 0.1
131 0.12
132 0.14
133 0.15
134 0.21
135 0.23
136 0.24
137 0.25
138 0.25
139 0.24
140 0.25
141 0.23
142 0.18
143 0.18
144 0.18
145 0.17
146 0.16
147 0.15
148 0.11
149 0.11
150 0.14
151 0.11
152 0.14
153 0.15
154 0.16
155 0.16
156 0.17
157 0.17
158 0.17
159 0.16
160 0.14
161 0.11
162 0.11
163 0.12
164 0.11
165 0.13
166 0.11
167 0.13
168 0.13
169 0.14
170 0.14
171 0.17
172 0.22
173 0.23
174 0.28
175 0.37
176 0.44
177 0.46
178 0.5
179 0.49
180 0.52
181 0.53
182 0.53
183 0.48
184 0.44
185 0.46
186 0.45
187 0.48
188 0.42
189 0.4
190 0.36
191 0.32
192 0.33
193 0.29
194 0.31
195 0.25
196 0.26
197 0.25
198 0.26
199 0.26
200 0.21
201 0.21
202 0.16
203 0.15
204 0.14
205 0.12
206 0.1
207 0.08
208 0.09
209 0.13
210 0.17
211 0.19
212 0.2
213 0.22
214 0.24
215 0.26
216 0.29
217 0.3
218 0.31
219 0.31
220 0.34
221 0.34
222 0.33
223 0.32
224 0.32
225 0.3
226 0.3
227 0.32
228 0.27
229 0.28
230 0.32
231 0.39
232 0.45
233 0.51
234 0.57
235 0.61
236 0.71
237 0.78
238 0.82
239 0.83