Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0K8L8G6

Protein Details
Accession A0A0K8L8G6    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
11-37ASVRIGKGTPRRKVKKVHKSSGADDKKBasic
NLS Segment(s)
PositionSequence
16-30GKGTPRRKVKKVHKS
Subcellular Location(s) nucl 16, mito_nucl 12.833, cyto_nucl 9.833, mito 8.5
Family & Domain DBs
Amino Acid Sequences MDQAKLARMQASVRIGKGTPRRKVKKVHKSSGADDKKLQTTLKKMNVQPIQAIEEVNMFKEDGNVIHFAAPKGEYLNADFPLPCPPPSPKEKTDEVTEIVHASVPSNTFALYGNGEEKELTELVPGILNQLGPDSLASLRKLAESYQNMQKQAGAEGKKDEDEDDIPDLVEGENFESNVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.29
3 0.35
4 0.44
5 0.47
6 0.49
7 0.57
8 0.64
9 0.69
10 0.79
11 0.82
12 0.84
13 0.85
14 0.86
15 0.84
16 0.82
17 0.81
18 0.81
19 0.77
20 0.69
21 0.62
22 0.57
23 0.5
24 0.47
25 0.43
26 0.37
27 0.37
28 0.43
29 0.47
30 0.5
31 0.49
32 0.55
33 0.57
34 0.54
35 0.48
36 0.41
37 0.36
38 0.29
39 0.27
40 0.18
41 0.17
42 0.16
43 0.14
44 0.12
45 0.09
46 0.09
47 0.09
48 0.09
49 0.07
50 0.08
51 0.08
52 0.08
53 0.1
54 0.11
55 0.11
56 0.11
57 0.11
58 0.1
59 0.1
60 0.1
61 0.09
62 0.1
63 0.13
64 0.12
65 0.12
66 0.12
67 0.11
68 0.16
69 0.17
70 0.15
71 0.15
72 0.16
73 0.2
74 0.27
75 0.32
76 0.29
77 0.33
78 0.35
79 0.36
80 0.37
81 0.34
82 0.3
83 0.25
84 0.22
85 0.18
86 0.15
87 0.13
88 0.09
89 0.08
90 0.07
91 0.07
92 0.07
93 0.07
94 0.07
95 0.07
96 0.08
97 0.08
98 0.08
99 0.08
100 0.09
101 0.09
102 0.09
103 0.09
104 0.09
105 0.1
106 0.09
107 0.08
108 0.07
109 0.07
110 0.07
111 0.08
112 0.07
113 0.06
114 0.07
115 0.07
116 0.06
117 0.07
118 0.06
119 0.06
120 0.06
121 0.06
122 0.07
123 0.1
124 0.11
125 0.11
126 0.12
127 0.12
128 0.13
129 0.13
130 0.2
131 0.22
132 0.27
133 0.35
134 0.39
135 0.4
136 0.39
137 0.39
138 0.32
139 0.32
140 0.34
141 0.27
142 0.25
143 0.28
144 0.3
145 0.29
146 0.29
147 0.25
148 0.22
149 0.21
150 0.22
151 0.21
152 0.19
153 0.17
154 0.16
155 0.16
156 0.12
157 0.12
158 0.09
159 0.09
160 0.1