Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7EGR5

Protein Details
Accession A7EGR5    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MGKGKIQRRKGKKASPKNMPGVSHydrophilic
NLS Segment(s)
PositionSequence
3-17KGKIQRRKGKKASPK
Subcellular Location(s) mito 19.5, cyto_mito 11, nucl 5
Family & Domain DBs
KEGG ssl:SS1G_04507  -  
Amino Acid Sequences MGKGKIQRRKGKKASPKNMPGVSLKNHLMARSFNAAATRQTMKVQGKYGRLVNERTDINVSGFETAVNSLLKLTFIQSQAWANSIRPQKTECLLMDLPPELAADAP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.9
3 0.89
4 0.87
5 0.79
6 0.71
7 0.65
8 0.58
9 0.52
10 0.47
11 0.39
12 0.36
13 0.34
14 0.32
15 0.29
16 0.25
17 0.24
18 0.23
19 0.22
20 0.18
21 0.19
22 0.19
23 0.18
24 0.21
25 0.19
26 0.16
27 0.16
28 0.22
29 0.24
30 0.25
31 0.3
32 0.31
33 0.31
34 0.33
35 0.35
36 0.34
37 0.33
38 0.32
39 0.28
40 0.27
41 0.24
42 0.23
43 0.22
44 0.17
45 0.15
46 0.13
47 0.12
48 0.09
49 0.09
50 0.08
51 0.07
52 0.06
53 0.07
54 0.07
55 0.06
56 0.06
57 0.06
58 0.07
59 0.06
60 0.08
61 0.1
62 0.11
63 0.12
64 0.14
65 0.16
66 0.16
67 0.18
68 0.17
69 0.15
70 0.21
71 0.27
72 0.28
73 0.28
74 0.29
75 0.32
76 0.33
77 0.38
78 0.31
79 0.32
80 0.3
81 0.3
82 0.3
83 0.27
84 0.25
85 0.19
86 0.19