Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A7E9G8

Protein Details
Accession A7E9G8    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
60-84LVRERGEGGKRKKKKAGKESWRMGABasic
NLS Segment(s)
PositionSequence
64-81RGEGGKRKKKKAGKESWR
Subcellular Location(s) cyto_nucl 8, nucl 7.5, cyto 7.5, mito 6, pero 2, E.R. 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG ssl:SS1G_01948  -  
Amino Acid Sequences MFLYGGIEEGEEGEEGEEGEEGEEGEEGEEGEEGEEGEVNVLFCVIFYFSGKGIIGMALLVRERGEGGKRKKKKAGKESWRMGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.06
4 0.05
5 0.04
6 0.05
7 0.04
8 0.04
9 0.04
10 0.04
11 0.04
12 0.04
13 0.04
14 0.04
15 0.04
16 0.04
17 0.04
18 0.04
19 0.04
20 0.04
21 0.04
22 0.04
23 0.04
24 0.04
25 0.04
26 0.03
27 0.03
28 0.03
29 0.03
30 0.03
31 0.03
32 0.03
33 0.03
34 0.04
35 0.05
36 0.05
37 0.07
38 0.07
39 0.07
40 0.07
41 0.06
42 0.06
43 0.05
44 0.05
45 0.04
46 0.04
47 0.05
48 0.05
49 0.05
50 0.06
51 0.08
52 0.14
53 0.23
54 0.33
55 0.44
56 0.52
57 0.61
58 0.7
59 0.76
60 0.81
61 0.83
62 0.84
63 0.84
64 0.87