Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A7F323

Protein Details
Accession A7F323    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
278-299HCMLAYKKSPHNKKRNLLTRFGHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 7, cyto 6.5, cyto_mito 6.5, mito 5.5, pero 3, E.R. 2, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001173  Glyco_trans_2-like  
IPR029044  Nucleotide-diphossugar_trans  
Gene Ontology GO:0016020  C:membrane  
KEGG ssl:SS1G_12321  -  
Pfam View protein in Pfam  
PF13632  Glyco_trans_2_3  
CDD cd06423  CESA_like  
Amino Acid Sequences MNVMEAICSLKPNRISRKALYDVEENGWKFPTPEDQLLILDLVIVAYLPNEQDIIMDRIHYALDHIVYPHDRIRINVLYNTPKAIEPVESEMNELAAKIDRLRIIKVPDSTSKAHNLNYFFTLYTGAQIIALYDCDHYSHPYGPRWAVERFLADEEVDCVQGRCVIQNSKATFLTGTIAVEFDKIYGTSHPGRAALFGYGLFTGSNGYWRANLPRDLKMDATMLTEDIDSALRALEQGSICIHEPNVISYELAPTTFHSFLKQRLRWVQGWTQASYRHCMLAYKKSPHNKKRNLLTRFGLLSLLLIRELSYYLVSQYTCLMLSFLITGFLKTGTQLKNLIFFEFPASEWLFIIGTLCLIGSLAITYFVLSELITKRMMVKFTLLYPFYLILGSCIGLYGHFRQIVRYSAWNATVRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.59
3 0.62
4 0.69
5 0.7
6 0.67
7 0.63
8 0.57
9 0.51
10 0.49
11 0.5
12 0.42
13 0.36
14 0.33
15 0.29
16 0.25
17 0.23
18 0.27
19 0.26
20 0.28
21 0.3
22 0.3
23 0.3
24 0.3
25 0.28
26 0.19
27 0.13
28 0.1
29 0.07
30 0.05
31 0.04
32 0.03
33 0.03
34 0.04
35 0.04
36 0.05
37 0.05
38 0.05
39 0.06
40 0.1
41 0.12
42 0.12
43 0.12
44 0.12
45 0.12
46 0.13
47 0.12
48 0.09
49 0.09
50 0.1
51 0.1
52 0.11
53 0.14
54 0.15
55 0.18
56 0.2
57 0.23
58 0.22
59 0.23
60 0.29
61 0.31
62 0.32
63 0.34
64 0.36
65 0.38
66 0.38
67 0.39
68 0.33
69 0.28
70 0.26
71 0.23
72 0.19
73 0.15
74 0.2
75 0.22
76 0.21
77 0.22
78 0.2
79 0.2
80 0.18
81 0.16
82 0.11
83 0.09
84 0.09
85 0.09
86 0.12
87 0.15
88 0.17
89 0.19
90 0.22
91 0.25
92 0.3
93 0.32
94 0.34
95 0.35
96 0.38
97 0.38
98 0.37
99 0.39
100 0.36
101 0.36
102 0.36
103 0.33
104 0.31
105 0.31
106 0.29
107 0.23
108 0.2
109 0.19
110 0.15
111 0.14
112 0.12
113 0.09
114 0.08
115 0.08
116 0.08
117 0.06
118 0.06
119 0.06
120 0.06
121 0.06
122 0.07
123 0.08
124 0.1
125 0.12
126 0.16
127 0.19
128 0.22
129 0.25
130 0.25
131 0.27
132 0.28
133 0.26
134 0.24
135 0.21
136 0.2
137 0.18
138 0.18
139 0.17
140 0.13
141 0.13
142 0.12
143 0.12
144 0.11
145 0.09
146 0.07
147 0.07
148 0.09
149 0.09
150 0.09
151 0.12
152 0.14
153 0.17
154 0.23
155 0.24
156 0.25
157 0.25
158 0.24
159 0.21
160 0.19
161 0.17
162 0.11
163 0.1
164 0.07
165 0.07
166 0.06
167 0.07
168 0.06
169 0.05
170 0.05
171 0.05
172 0.05
173 0.06
174 0.1
175 0.12
176 0.13
177 0.14
178 0.14
179 0.14
180 0.14
181 0.14
182 0.1
183 0.08
184 0.07
185 0.07
186 0.06
187 0.06
188 0.05
189 0.04
190 0.05
191 0.05
192 0.07
193 0.07
194 0.07
195 0.08
196 0.09
197 0.13
198 0.15
199 0.21
200 0.22
201 0.25
202 0.27
203 0.28
204 0.27
205 0.25
206 0.23
207 0.17
208 0.16
209 0.11
210 0.09
211 0.08
212 0.08
213 0.06
214 0.06
215 0.06
216 0.04
217 0.04
218 0.04
219 0.03
220 0.04
221 0.04
222 0.07
223 0.06
224 0.07
225 0.07
226 0.09
227 0.09
228 0.1
229 0.09
230 0.09
231 0.09
232 0.1
233 0.11
234 0.1
235 0.1
236 0.1
237 0.11
238 0.09
239 0.09
240 0.08
241 0.08
242 0.12
243 0.13
244 0.13
245 0.15
246 0.17
247 0.24
248 0.34
249 0.34
250 0.36
251 0.42
252 0.47
253 0.47
254 0.5
255 0.48
256 0.45
257 0.46
258 0.41
259 0.37
260 0.36
261 0.35
262 0.33
263 0.29
264 0.23
265 0.2
266 0.22
267 0.24
268 0.3
269 0.36
270 0.4
271 0.46
272 0.54
273 0.65
274 0.71
275 0.78
276 0.77
277 0.78
278 0.82
279 0.85
280 0.81
281 0.76
282 0.69
283 0.63
284 0.54
285 0.46
286 0.36
287 0.26
288 0.21
289 0.16
290 0.14
291 0.08
292 0.07
293 0.06
294 0.07
295 0.07
296 0.07
297 0.07
298 0.07
299 0.07
300 0.09
301 0.09
302 0.09
303 0.1
304 0.1
305 0.09
306 0.09
307 0.08
308 0.06
309 0.07
310 0.07
311 0.06
312 0.08
313 0.08
314 0.08
315 0.09
316 0.09
317 0.09
318 0.09
319 0.17
320 0.16
321 0.19
322 0.22
323 0.22
324 0.29
325 0.3
326 0.3
327 0.23
328 0.22
329 0.23
330 0.2
331 0.2
332 0.17
333 0.17
334 0.16
335 0.15
336 0.16
337 0.12
338 0.11
339 0.12
340 0.07
341 0.06
342 0.06
343 0.05
344 0.04
345 0.04
346 0.04
347 0.03
348 0.04
349 0.04
350 0.05
351 0.05
352 0.05
353 0.05
354 0.06
355 0.06
356 0.05
357 0.1
358 0.11
359 0.14
360 0.14
361 0.15
362 0.2
363 0.23
364 0.25
365 0.21
366 0.23
367 0.24
368 0.28
369 0.35
370 0.3
371 0.28
372 0.28
373 0.27
374 0.24
375 0.22
376 0.17
377 0.11
378 0.11
379 0.11
380 0.09
381 0.08
382 0.08
383 0.08
384 0.12
385 0.15
386 0.19
387 0.23
388 0.23
389 0.27
390 0.3
391 0.34
392 0.34
393 0.36
394 0.35
395 0.35
396 0.41