FuNGI

A0A0F8B3M5

Protein Details

Accession

A0A0F8B3M5

Localization Confidence

Low

Confidence Score

8.9

NoLS Segment(s)

Position	Sequence	Protein Nature
4-33	VPGKYKGCETCRRRRVKCDNMRPICRKCVS	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

nucl 13.5, cyto_nucl 9.5, mito 7, cyto 4.5

Family & Domain DBs

InterPro	View protein in InterPro IPR029055 Ntn_hydrolases_N IPR023332 Proteasome_alpha-type IPR001353 Proteasome_sua/b IPR036864 Zn2-C6_fun-type_DNA-bd_sf IPR001138 Zn2Cys6_DnaBD
Gene Ontology	GO:0005634 C:nucleus GO:0019773 C:proteasome core complex, alpha-subunit complex GO:0000981 F:DNA-binding transcription factor activity, RNA polymerase II-specific GO:0016787 F:hydrolase activity GO:0008270 F:zinc ion binding GO:0051603 P:proteolysis involved in protein catabolic process
Pfam	View protein in Pfam PF00227 Proteasome PF00172 Zn_clus
PROSITE	View protein in PROSITE PS51475 PROTEASOME_ALPHA_2 PS00463 ZN2_CY6_FUNGAL_1 PS50048 ZN2_CY6_FUNGAL_2
CDD	cd00067 GAL4 cd03755 proteasome_alpha_type_7

Amino Acid Sequences

MVGVPGKYKGCETCRRRRVKCDNMRPICRKCVSTGRSCEGYERQMIFITATPEDGGREPLRPAWDDLLFLSDKHSYYTTQIVSLQTKLAHVSRGVSSSIFSPPSYELPDFRPASSSGEFSVSGQCIVNIDSASEPKSGLCVFLYEPNNCSSSPPETSQWKGPHDYMNTVQAAGPQAFTLFPAHHFFSRTAWSLLTRKATHLAQRDWATTPWQYYPKSLIDRLFDILVQIPDLLERADATSHHVPTQDRQLKIQDLLTRCLYIDRQLNEWCAIAAQDPEDSHRHSYWISRSPQTQASMPFSETFAFINAATAVGFLYYWMGSLLLNRSILNLHRLFSQPAVDYNMYPPVLPVELNIDVSNYQRDGIFAANICCSLDFALNTSTQPDVLAGPLAVADMYFKGFQGGGQSQLETACPDGHVFQVEYASEAVKRGTCAVGVKGKDVVVLGCEKRSAMKLQDTRITPSKLGLLDNHVCLAFAGLNADARILVDKARIEAQSHRLTVEDPVTIEYITKYVAGVQQRYTQSGGVRPFGISTLIVGFDKGSEVPRLYQTEPSGIYSAWKANAIGRSSKTVREFLERNYKDDMDRDATVRLAIKSLLEVVQTGAKNIEIALMAPGKSIEMMPLEEIEAFVKSIEEEKQEEAAKKKTGRTPGTGTATILTRGPDDAE

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.66
2	0.76
3	0.8
4	0.83
5	0.86
6	0.87
7	0.9
8	0.9
9	0.91
10	0.9
11	0.94
12	0.92
13	0.87
14	0.86
15	0.8
16	0.71
17	0.66
18	0.66
19	0.62
20	0.63
21	0.64
22	0.61
23	0.6
24	0.59
25	0.58
26	0.52
27	0.5
28	0.48
29	0.42
30	0.36
31	0.33
32	0.33
33	0.29
34	0.26
35	0.24
36	0.17
37	0.16
38	0.15
39	0.14
40	0.16
41	0.16
42	0.19
43	0.17
44	0.19
45	0.19
46	0.23
47	0.27
48	0.27
49	0.29
50	0.28
51	0.27
52	0.26
53	0.25
54	0.26
55	0.22
56	0.2
57	0.19
58	0.18
59	0.17
60	0.19
61	0.2
62	0.17
63	0.19
64	0.26
65	0.23
66	0.22
67	0.25
68	0.27
69	0.28
70	0.28
71	0.27
72	0.22
73	0.22
74	0.23
75	0.22
76	0.2
77	0.18
78	0.2
79	0.2
80	0.21
81	0.21
82	0.18
83	0.17
84	0.17
85	0.2
86	0.18
87	0.16
88	0.16
89	0.18
90	0.2
91	0.25
92	0.24
93	0.22
94	0.25
95	0.34
96	0.33
97	0.31
98	0.31
99	0.27
100	0.31
101	0.3
102	0.27
103	0.2
104	0.21
105	0.21
106	0.19
107	0.22
108	0.17
109	0.17
110	0.15
111	0.14
112	0.12
113	0.13
114	0.14
115	0.09
116	0.1
117	0.1
118	0.11
119	0.13
120	0.13
121	0.12
122	0.1
123	0.13
124	0.12
125	0.12
126	0.11
127	0.1
128	0.11
129	0.19
130	0.23
131	0.22
132	0.24
133	0.25
134	0.26
135	0.24
136	0.24
137	0.2
138	0.2
139	0.23
140	0.25
141	0.28
142	0.31
143	0.35
144	0.41
145	0.43
146	0.42
147	0.42
148	0.41
149	0.43
150	0.41
151	0.42
152	0.36
153	0.36
154	0.33
155	0.29
156	0.27
157	0.22
158	0.22
159	0.18
160	0.16
161	0.1
162	0.1
163	0.09
164	0.1
165	0.1
166	0.08
167	0.1
168	0.14
169	0.16
170	0.17
171	0.19
172	0.19
173	0.2
174	0.23
175	0.24
176	0.21
177	0.2
178	0.22
179	0.24
180	0.27
181	0.31
182	0.28
183	0.27
184	0.3
185	0.32
186	0.35
187	0.38
188	0.36
189	0.36
190	0.38
191	0.38
192	0.36
193	0.34
194	0.31
195	0.25
196	0.25
197	0.23
198	0.26
199	0.25
200	0.25
201	0.28
202	0.31
203	0.33
204	0.35
205	0.33
206	0.3
207	0.31
208	0.31
209	0.27
210	0.21
211	0.17
212	0.16
213	0.13
214	0.11
215	0.09
216	0.07
217	0.07
218	0.07
219	0.06
220	0.04
221	0.04
222	0.05
223	0.05
224	0.06
225	0.12
226	0.16
227	0.16
228	0.17
229	0.2
230	0.2
231	0.22
232	0.33
233	0.33
234	0.3
235	0.31
236	0.34
237	0.33
238	0.34
239	0.35
240	0.29
241	0.25
242	0.28
243	0.27
244	0.23
245	0.21
246	0.22
247	0.18
248	0.17
249	0.21
250	0.19
251	0.21
252	0.22
253	0.24
254	0.23
255	0.23
256	0.18
257	0.12
258	0.11
259	0.09
260	0.07
261	0.06
262	0.06
263	0.07
264	0.09
265	0.11
266	0.13
267	0.15
268	0.15
269	0.15
270	0.15
271	0.19
272	0.22
273	0.28
274	0.3
275	0.3
276	0.31
277	0.33
278	0.36
279	0.34
280	0.31
281	0.26
282	0.27
283	0.25
284	0.25
285	0.22
286	0.19
287	0.17
288	0.15
289	0.13
290	0.09
291	0.08
292	0.07
293	0.07
294	0.06
295	0.06
296	0.05
297	0.05
298	0.04
299	0.03
300	0.03
301	0.03
302	0.03
303	0.03
304	0.03
305	0.03
306	0.04
307	0.03
308	0.05
309	0.06
310	0.07
311	0.08
312	0.07
313	0.08
314	0.09
315	0.09
316	0.14
317	0.13
318	0.12
319	0.14
320	0.15
321	0.15
322	0.15
323	0.16
324	0.11
325	0.12
326	0.15
327	0.14
328	0.13
329	0.13
330	0.15
331	0.14
332	0.13
333	0.12
334	0.09
335	0.09
336	0.08
337	0.07
338	0.08
339	0.08
340	0.09
341	0.09
342	0.09
343	0.09
344	0.1
345	0.11
346	0.07
347	0.07
348	0.06
349	0.07
350	0.07
351	0.07
352	0.07
353	0.07
354	0.08
355	0.08
356	0.08
357	0.08
358	0.07
359	0.07
360	0.06
361	0.06
362	0.05
363	0.07
364	0.08
365	0.09
366	0.09
367	0.1
368	0.09
369	0.08
370	0.08
371	0.07
372	0.06
373	0.05
374	0.06
375	0.04
376	0.04
377	0.04
378	0.04
379	0.03
380	0.03
381	0.03
382	0.03
383	0.04
384	0.05
385	0.05
386	0.05
387	0.05
388	0.06
389	0.1
390	0.1
391	0.12
392	0.13
393	0.13
394	0.13
395	0.13
396	0.13
397	0.09
398	0.09
399	0.06
400	0.06
401	0.07
402	0.07
403	0.07
404	0.08
405	0.08
406	0.07
407	0.08
408	0.08
409	0.08
410	0.08
411	0.08
412	0.07
413	0.07
414	0.08
415	0.08
416	0.08
417	0.08
418	0.08
419	0.09
420	0.1
421	0.13
422	0.18
423	0.18
424	0.19
425	0.19
426	0.18
427	0.18
428	0.17
429	0.13
430	0.09
431	0.13
432	0.13
433	0.12
434	0.12
435	0.12
436	0.13
437	0.15
438	0.17
439	0.17
440	0.25
441	0.29
442	0.32
443	0.39
444	0.39
445	0.42
446	0.45
447	0.43
448	0.35
449	0.31
450	0.31
451	0.26
452	0.26
453	0.22
454	0.23
455	0.23
456	0.23
457	0.23
458	0.19
459	0.17
460	0.16
461	0.15
462	0.09
463	0.06
464	0.07
465	0.06
466	0.07
467	0.07
468	0.07
469	0.06
470	0.05
471	0.07
472	0.06
473	0.07
474	0.09
475	0.09
476	0.11
477	0.14
478	0.15
479	0.16
480	0.2
481	0.27
482	0.3
483	0.3
484	0.29
485	0.26
486	0.26
487	0.27
488	0.24
489	0.18
490	0.12
491	0.13
492	0.14
493	0.13
494	0.13
495	0.1
496	0.09
497	0.08
498	0.08
499	0.06
500	0.08
501	0.12
502	0.16
503	0.18
504	0.2
505	0.27
506	0.29
507	0.31
508	0.3
509	0.28
510	0.26
511	0.29
512	0.3
513	0.25
514	0.24
515	0.22
516	0.21
517	0.2
518	0.18
519	0.12
520	0.1
521	0.09
522	0.1
523	0.09
524	0.09
525	0.09
526	0.08
527	0.09
528	0.09
529	0.1
530	0.11
531	0.12
532	0.15
533	0.2
534	0.24
535	0.24
536	0.28
537	0.28
538	0.3
539	0.3
540	0.3
541	0.27
542	0.22
543	0.22
544	0.2
545	0.21
546	0.18
547	0.17
548	0.15
549	0.19
550	0.24
551	0.25
552	0.28
553	0.28
554	0.34
555	0.35
556	0.41
557	0.4
558	0.39
559	0.39
560	0.41
561	0.42
562	0.42
563	0.51
564	0.46
565	0.46
566	0.47
567	0.46
568	0.4
569	0.4
570	0.38
571	0.32
572	0.32
573	0.31
574	0.26
575	0.25
576	0.26
577	0.26
578	0.2
579	0.17
580	0.15
581	0.14
582	0.14
583	0.15
584	0.14
585	0.12
586	0.11
587	0.11
588	0.17
589	0.17
590	0.17
591	0.15
592	0.14
593	0.14
594	0.14
595	0.14
596	0.08
597	0.08
598	0.11
599	0.13
600	0.13
601	0.13
602	0.13
603	0.11
604	0.12
605	0.12
606	0.1
607	0.09
608	0.11
609	0.11
610	0.12
611	0.12
612	0.12
613	0.12
614	0.11
615	0.1
616	0.09
617	0.08
618	0.08
619	0.08
620	0.1
621	0.13
622	0.16
623	0.18
624	0.2
625	0.25
626	0.3
627	0.35
628	0.37
629	0.41
630	0.45
631	0.48
632	0.53
633	0.55
634	0.61
635	0.61
636	0.63
637	0.64
638	0.65
639	0.67
640	0.61
641	0.55
642	0.47
643	0.43
644	0.37
645	0.31
646	0.23
647	0.17

A0A0F8B3M5

3D AlphaFold-predicted Structure Viewer