Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7E636

Protein Details
Accession A7E636    Localization Confidence High Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
11-37AATKTATKGKKAPPKKRQPEPESESETHydrophilic
NLS Segment(s)
PositionSequence
8-28KPKAATKTATKGKKAPPKKRQ
Subcellular Location(s) nucl 20, cyto 4, mito 3
Family & Domain DBs
KEGG ssl:SS1G_00761  -  
Amino Acid Sequences MASQAASKPKAATKTATKGKKAPPKKRQPEPESESETETDSDDYTSEESEEEAPPPRRQAKQKQQKQGGGGGPLGGVGDMVPLGQATDTVGGVAGQAGNTLGNVAGGVLGGGEKKGDDKEDTLRLRLDLNLEVEITLKAKIHGDLELALLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.56
3 0.61
4 0.61
5 0.63
6 0.7
7 0.74
8 0.77
9 0.78
10 0.79
11 0.83
12 0.88
13 0.91
14 0.92
15 0.88
16 0.88
17 0.84
18 0.81
19 0.77
20 0.68
21 0.6
22 0.5
23 0.44
24 0.34
25 0.27
26 0.2
27 0.13
28 0.11
29 0.09
30 0.09
31 0.08
32 0.08
33 0.07
34 0.06
35 0.07
36 0.09
37 0.09
38 0.09
39 0.15
40 0.19
41 0.19
42 0.24
43 0.29
44 0.33
45 0.41
46 0.5
47 0.55
48 0.63
49 0.71
50 0.76
51 0.79
52 0.76
53 0.7
54 0.65
55 0.56
56 0.47
57 0.38
58 0.27
59 0.19
60 0.15
61 0.13
62 0.06
63 0.04
64 0.02
65 0.02
66 0.02
67 0.02
68 0.02
69 0.02
70 0.02
71 0.02
72 0.02
73 0.02
74 0.03
75 0.03
76 0.03
77 0.03
78 0.03
79 0.03
80 0.04
81 0.03
82 0.03
83 0.03
84 0.03
85 0.03
86 0.03
87 0.03
88 0.03
89 0.03
90 0.03
91 0.03
92 0.03
93 0.02
94 0.02
95 0.02
96 0.02
97 0.03
98 0.03
99 0.03
100 0.03
101 0.05
102 0.06
103 0.09
104 0.11
105 0.13
106 0.19
107 0.28
108 0.3
109 0.31
110 0.31
111 0.29
112 0.29
113 0.27
114 0.25
115 0.19
116 0.19
117 0.17
118 0.16
119 0.16
120 0.15
121 0.15
122 0.13
123 0.11
124 0.09
125 0.1
126 0.11
127 0.13
128 0.14
129 0.14
130 0.15
131 0.14