Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A7F251

Protein Details
Accession A7F251    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
37-67RTIQRRGISKNRKGRERRESRKKGMKERRNRBasic
NLS Segment(s)
PositionSequence
40-67QRRGISKNRKGRERRESRKKGMKERRNR
Subcellular Location(s) plas 10, mito 5, golg 4, mito_nucl 4, nucl 3, E.R. 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG ssl:SS1G_11672  -  
Amino Acid Sequences MPSIDHNEKYFWQIALPVAFAVICFLMRDMILWWFRRTIQRRGISKNRKGRERRESRKKGMKERRNR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.18
3 0.18
4 0.13
5 0.1
6 0.1
7 0.09
8 0.08
9 0.05
10 0.04
11 0.04
12 0.04
13 0.05
14 0.05
15 0.05
16 0.05
17 0.08
18 0.11
19 0.13
20 0.14
21 0.14
22 0.16
23 0.25
24 0.29
25 0.33
26 0.39
27 0.46
28 0.51
29 0.59
30 0.68
31 0.69
32 0.74
33 0.77
34 0.76
35 0.77
36 0.8
37 0.81
38 0.81
39 0.82
40 0.84
41 0.86
42 0.88
43 0.88
44 0.91
45 0.9
46 0.9
47 0.9