Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0F8B7T1

Protein Details
Accession A0A0F8B7T1    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
46-79EAEPMREKIKTKRRNRKTKKAKSKHRYTILRISDBasic
NLS Segment(s)
PositionSequence
51-71REKIKTKRRNRKTKKAKSKHR
Subcellular Location(s) nucl 20, cyto_nucl 15.5, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR036164  L21-like_sf  
IPR028909  L21p-like  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005840  C:ribosome  
GO:0003994  F:aconitate hydratase activity  
GO:0047780  F:citrate dehydratase activity  
Pfam View protein in Pfam  
PF00829  Ribosomal_L21p  
Amino Acid Sequences MPGSEPGDELKLNCASVLGSRDLTLKGSPYIDERLFECRAIVVGEEAEPMREKIKTKRRNRKTKKAKSKHRYTILRISDLKINEVPV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.12
3 0.14
4 0.16
5 0.14
6 0.13
7 0.13
8 0.15
9 0.15
10 0.17
11 0.15
12 0.13
13 0.12
14 0.13
15 0.13
16 0.14
17 0.18
18 0.17
19 0.17
20 0.16
21 0.2
22 0.2
23 0.19
24 0.17
25 0.12
26 0.12
27 0.11
28 0.1
29 0.05
30 0.05
31 0.05
32 0.05
33 0.05
34 0.05
35 0.06
36 0.06
37 0.07
38 0.09
39 0.11
40 0.2
41 0.31
42 0.41
43 0.52
44 0.63
45 0.72
46 0.82
47 0.9
48 0.92
49 0.93
50 0.94
51 0.95
52 0.95
53 0.95
54 0.94
55 0.95
56 0.94
57 0.93
58 0.9
59 0.86
60 0.85
61 0.79
62 0.76
63 0.67
64 0.6
65 0.55
66 0.48
67 0.45