Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F8BSX3

Protein Details
Accession A0A0F8BSX3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
15-41LLWKIPWRLSKFQKRRHRERLRAVDGVHydrophilic
NLS Segment(s)
PositionSequence
29-30RR
Subcellular Location(s) mito 23.5, cyto_mito 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFRVTNPLSSGLLWKIPWRLSKFQKRRHRERLRAVDGVVATLDAAMKQTGQTVAALERWKEEMPREEQMMPRDKYTMFDRKVKGYRKGIHKLPKWTRVSQRVNPPGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.19
3 0.18
4 0.2
5 0.22
6 0.25
7 0.32
8 0.35
9 0.41
10 0.49
11 0.6
12 0.67
13 0.73
14 0.8
15 0.82
16 0.87
17 0.9
18 0.9
19 0.89
20 0.9
21 0.9
22 0.86
23 0.78
24 0.67
25 0.59
26 0.47
27 0.38
28 0.27
29 0.15
30 0.09
31 0.07
32 0.06
33 0.03
34 0.04
35 0.03
36 0.03
37 0.04
38 0.04
39 0.05
40 0.05
41 0.05
42 0.05
43 0.06
44 0.09
45 0.1
46 0.09
47 0.1
48 0.11
49 0.12
50 0.12
51 0.14
52 0.17
53 0.2
54 0.23
55 0.25
56 0.25
57 0.28
58 0.32
59 0.38
60 0.34
61 0.31
62 0.3
63 0.27
64 0.29
65 0.32
66 0.36
67 0.32
68 0.38
69 0.4
70 0.47
71 0.55
72 0.59
73 0.61
74 0.61
75 0.65
76 0.67
77 0.73
78 0.73
79 0.76
80 0.75
81 0.77
82 0.77
83 0.79
84 0.76
85 0.76
86 0.78
87 0.78
88 0.8
89 0.77
90 0.79