Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F8B4F4

Protein Details
Accession A0A0F8B4F4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
67-86EVLPRKKRTAIKQKDSPTRLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, mito 12, cyto_mito 8.333, cyto_nucl 8.166
Family & Domain DBs
Amino Acid Sequences MAAILRGKKNNPAHSVSMSALRLKDIEKIVSFYGISGQSEEVLGEDDEDLGVEDAGEQWATDKPTDEVLPRKKRTAIKQKDSPTRLEAENMPLVEKLVLSDDDIED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.52
3 0.44
4 0.4
5 0.34
6 0.31
7 0.25
8 0.22
9 0.2
10 0.18
11 0.21
12 0.18
13 0.2
14 0.18
15 0.2
16 0.2
17 0.2
18 0.19
19 0.14
20 0.15
21 0.13
22 0.12
23 0.1
24 0.1
25 0.09
26 0.09
27 0.09
28 0.06
29 0.06
30 0.06
31 0.05
32 0.05
33 0.05
34 0.04
35 0.04
36 0.04
37 0.03
38 0.03
39 0.03
40 0.02
41 0.03
42 0.03
43 0.03
44 0.03
45 0.04
46 0.05
47 0.07
48 0.07
49 0.08
50 0.08
51 0.11
52 0.12
53 0.14
54 0.21
55 0.3
56 0.39
57 0.41
58 0.44
59 0.49
60 0.55
61 0.63
62 0.66
63 0.67
64 0.66
65 0.73
66 0.79
67 0.82
68 0.78
69 0.72
70 0.64
71 0.57
72 0.48
73 0.43
74 0.35
75 0.3
76 0.32
77 0.28
78 0.25
79 0.21
80 0.21
81 0.18
82 0.16
83 0.11
84 0.1
85 0.1
86 0.1