Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F8AYQ9

Protein Details
Accession A0A0F8AYQ9   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MAPPPRRIVRKKPLSERLSAHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 9, mito 8, cyto 4.5, cyto_nucl 3, E.R. 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR018819  Nur1/Mug154  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF10332  DUF2418  
Amino Acid Sequences MAPPPRRIVRKKPLSERLSAVLNPMDFLLWLSEEMETREYDPETLGLKLGLAMHVVFLLARSNSASEDVDDLFGDGGSSSSMAYLSRALVWTLVLGCLVNAYYTTTRVRLYRLFQHNIDAVPDTKSAKRVNVQSTPSAASPIRLFKHALRPESAEDRSHPDKTRDVWELAVWDPLPLSLRIACIFSPAHALVYLTFLPISRDDPQPSITVLNCLVLQTVLSLQLLLVQSCFAQQAKDTALVNREVMNEYNTKFVHPRLHPTVRDAATQANITETVKDLYGNDVWVGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.79
3 0.73
4 0.65
5 0.59
6 0.49
7 0.42
8 0.35
9 0.3
10 0.25
11 0.21
12 0.17
13 0.12
14 0.12
15 0.1
16 0.08
17 0.08
18 0.08
19 0.09
20 0.1
21 0.11
22 0.12
23 0.12
24 0.13
25 0.15
26 0.15
27 0.14
28 0.14
29 0.15
30 0.15
31 0.14
32 0.13
33 0.11
34 0.1
35 0.1
36 0.1
37 0.08
38 0.07
39 0.07
40 0.07
41 0.06
42 0.06
43 0.05
44 0.05
45 0.07
46 0.06
47 0.07
48 0.07
49 0.08
50 0.09
51 0.11
52 0.11
53 0.09
54 0.12
55 0.12
56 0.11
57 0.11
58 0.1
59 0.08
60 0.08
61 0.07
62 0.05
63 0.04
64 0.04
65 0.04
66 0.04
67 0.04
68 0.04
69 0.04
70 0.05
71 0.06
72 0.06
73 0.07
74 0.07
75 0.07
76 0.07
77 0.07
78 0.07
79 0.07
80 0.06
81 0.05
82 0.05
83 0.04
84 0.04
85 0.04
86 0.04
87 0.04
88 0.06
89 0.06
90 0.09
91 0.1
92 0.12
93 0.13
94 0.14
95 0.17
96 0.18
97 0.22
98 0.29
99 0.35
100 0.38
101 0.37
102 0.39
103 0.37
104 0.34
105 0.31
106 0.22
107 0.16
108 0.14
109 0.14
110 0.14
111 0.13
112 0.17
113 0.18
114 0.19
115 0.23
116 0.27
117 0.31
118 0.35
119 0.36
120 0.33
121 0.34
122 0.32
123 0.28
124 0.25
125 0.19
126 0.14
127 0.14
128 0.17
129 0.16
130 0.15
131 0.17
132 0.17
133 0.27
134 0.3
135 0.31
136 0.28
137 0.29
138 0.31
139 0.34
140 0.33
141 0.24
142 0.21
143 0.26
144 0.28
145 0.3
146 0.29
147 0.27
148 0.28
149 0.3
150 0.34
151 0.3
152 0.27
153 0.24
154 0.22
155 0.22
156 0.19
157 0.18
158 0.13
159 0.1
160 0.09
161 0.08
162 0.09
163 0.07
164 0.08
165 0.07
166 0.08
167 0.09
168 0.1
169 0.1
170 0.11
171 0.11
172 0.1
173 0.13
174 0.12
175 0.12
176 0.11
177 0.11
178 0.09
179 0.12
180 0.11
181 0.08
182 0.08
183 0.08
184 0.09
185 0.1
186 0.13
187 0.13
188 0.17
189 0.19
190 0.21
191 0.22
192 0.22
193 0.22
194 0.21
195 0.18
196 0.16
197 0.14
198 0.14
199 0.12
200 0.11
201 0.1
202 0.08
203 0.08
204 0.06
205 0.06
206 0.06
207 0.06
208 0.06
209 0.05
210 0.09
211 0.1
212 0.09
213 0.09
214 0.08
215 0.08
216 0.09
217 0.11
218 0.08
219 0.08
220 0.08
221 0.12
222 0.13
223 0.17
224 0.18
225 0.19
226 0.21
227 0.22
228 0.23
229 0.21
230 0.21
231 0.2
232 0.2
233 0.2
234 0.21
235 0.2
236 0.25
237 0.24
238 0.25
239 0.25
240 0.28
241 0.34
242 0.34
243 0.42
244 0.46
245 0.54
246 0.53
247 0.55
248 0.6
249 0.53
250 0.52
251 0.44
252 0.38
253 0.33
254 0.33
255 0.28
256 0.21
257 0.2
258 0.18
259 0.18
260 0.16
261 0.14
262 0.13
263 0.14
264 0.12
265 0.16
266 0.16
267 0.16