Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0F8DE05

Protein Details
Accession A0A0F8DE05    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
141-166QDKGKEKAAGKQKKKAKKIKLSFDEEBasic
NLS Segment(s)
PositionSequence
126-128KRR
143-160KGKEKAAGKQKKKAKKIK
Subcellular Location(s) nucl 13.5, mito_nucl 13.333, mito 12, cyto_mito 7.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR027911  DUF4604  
Pfam View protein in Pfam  
PF15377  DUF4604  
Amino Acid Sequences MSQKGYKNLSYTATVPPFLARLRSQAPDSSFSADSDGPDPILAARRRPAAAKRSASEEAEDTPLVLDENGNVVNADVAADGSVSVKAPQGEADTETKTEPKTNACLERTDTPKKQETAAIGSPSRKRRAARVIGADGDDDQDKGKEKAAGKQKKKAKKIKLSFDEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.29
3 0.26
4 0.26
5 0.24
6 0.26
7 0.19
8 0.21
9 0.25
10 0.28
11 0.29
12 0.32
13 0.34
14 0.33
15 0.34
16 0.33
17 0.3
18 0.27
19 0.27
20 0.22
21 0.21
22 0.18
23 0.16
24 0.12
25 0.11
26 0.11
27 0.09
28 0.16
29 0.16
30 0.17
31 0.2
32 0.23
33 0.24
34 0.28
35 0.34
36 0.34
37 0.41
38 0.43
39 0.41
40 0.45
41 0.46
42 0.43
43 0.38
44 0.31
45 0.24
46 0.21
47 0.2
48 0.13
49 0.11
50 0.1
51 0.09
52 0.07
53 0.05
54 0.03
55 0.05
56 0.05
57 0.05
58 0.05
59 0.04
60 0.04
61 0.04
62 0.04
63 0.03
64 0.03
65 0.03
66 0.03
67 0.03
68 0.03
69 0.03
70 0.03
71 0.04
72 0.05
73 0.05
74 0.05
75 0.06
76 0.07
77 0.07
78 0.09
79 0.11
80 0.11
81 0.11
82 0.12
83 0.13
84 0.12
85 0.14
86 0.14
87 0.14
88 0.17
89 0.21
90 0.27
91 0.27
92 0.28
93 0.29
94 0.34
95 0.38
96 0.42
97 0.41
98 0.41
99 0.45
100 0.44
101 0.42
102 0.39
103 0.35
104 0.34
105 0.34
106 0.33
107 0.29
108 0.33
109 0.38
110 0.42
111 0.45
112 0.43
113 0.42
114 0.46
115 0.54
116 0.58
117 0.59
118 0.59
119 0.58
120 0.54
121 0.53
122 0.45
123 0.35
124 0.29
125 0.21
126 0.14
127 0.11
128 0.11
129 0.13
130 0.13
131 0.16
132 0.2
133 0.22
134 0.3
135 0.4
136 0.49
137 0.54
138 0.63
139 0.69
140 0.74
141 0.82
142 0.84
143 0.85
144 0.85
145 0.88
146 0.9