Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F8DL67

Protein Details
Accession A0A0F8DL67   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
294-320TTPGSKPTSSCKRRRAIRNSGRMYKGAHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR004302  Cellulose/chitin-bd_N  
Pfam View protein in Pfam  
PF03067  LPMO_10  
Amino Acid Sequences MKSSVFSIISMASVVYGHGRVMSPPSRAPGPAFEAACGQSMYNQMTSDPNGNIENMLQNKAANYDPNTCQLPLCRGYKFDDNKDNVQSYTAGQTIDFQVDVAAPHTGIANVSVVDTGSFSTIGEPLISWTNYASSQTGVAANNSVFSVVLPSGLPSICGTAGNCVLQWWWFSEVAQQTYISCVDFTTGSGGSDTGNGGTAPSSAAPSSTYAPSAGNTPAVNTPAGNTPAGNTPTAPTTLQTSTSASSASTPQPEYGAPANDPAILTAADPTTAPTTAPTTPQANPVAPTGVQPTTPGSKPTSSCKRRRAIRNSGRMYKGASR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.08
3 0.08
4 0.08
5 0.09
6 0.1
7 0.11
8 0.17
9 0.21
10 0.23
11 0.25
12 0.29
13 0.3
14 0.31
15 0.32
16 0.3
17 0.32
18 0.34
19 0.32
20 0.28
21 0.29
22 0.28
23 0.28
24 0.23
25 0.17
26 0.14
27 0.17
28 0.18
29 0.17
30 0.16
31 0.16
32 0.18
33 0.2
34 0.22
35 0.19
36 0.19
37 0.18
38 0.18
39 0.18
40 0.16
41 0.2
42 0.18
43 0.2
44 0.18
45 0.17
46 0.18
47 0.19
48 0.2
49 0.18
50 0.2
51 0.23
52 0.25
53 0.29
54 0.31
55 0.29
56 0.28
57 0.27
58 0.28
59 0.28
60 0.29
61 0.26
62 0.26
63 0.3
64 0.39
65 0.42
66 0.44
67 0.48
68 0.49
69 0.52
70 0.55
71 0.52
72 0.43
73 0.38
74 0.31
75 0.23
76 0.22
77 0.18
78 0.14
79 0.12
80 0.13
81 0.13
82 0.13
83 0.11
84 0.08
85 0.07
86 0.07
87 0.08
88 0.07
89 0.06
90 0.05
91 0.06
92 0.06
93 0.06
94 0.05
95 0.06
96 0.05
97 0.05
98 0.05
99 0.05
100 0.05
101 0.05
102 0.05
103 0.04
104 0.05
105 0.05
106 0.04
107 0.05
108 0.05
109 0.06
110 0.05
111 0.05
112 0.06
113 0.09
114 0.09
115 0.08
116 0.08
117 0.09
118 0.09
119 0.1
120 0.09
121 0.07
122 0.07
123 0.08
124 0.1
125 0.09
126 0.09
127 0.09
128 0.08
129 0.08
130 0.08
131 0.07
132 0.05
133 0.05
134 0.06
135 0.04
136 0.05
137 0.05
138 0.05
139 0.06
140 0.06
141 0.06
142 0.05
143 0.06
144 0.06
145 0.06
146 0.06
147 0.07
148 0.08
149 0.07
150 0.07
151 0.06
152 0.06
153 0.07
154 0.07
155 0.07
156 0.08
157 0.08
158 0.08
159 0.12
160 0.15
161 0.15
162 0.16
163 0.14
164 0.12
165 0.13
166 0.14
167 0.1
168 0.07
169 0.06
170 0.06
171 0.06
172 0.06
173 0.07
174 0.07
175 0.07
176 0.07
177 0.07
178 0.07
179 0.07
180 0.07
181 0.05
182 0.05
183 0.05
184 0.05
185 0.05
186 0.05
187 0.05
188 0.05
189 0.05
190 0.05
191 0.05
192 0.06
193 0.08
194 0.1
195 0.1
196 0.1
197 0.1
198 0.11
199 0.11
200 0.12
201 0.11
202 0.11
203 0.1
204 0.12
205 0.12
206 0.13
207 0.13
208 0.11
209 0.12
210 0.14
211 0.16
212 0.14
213 0.13
214 0.13
215 0.18
216 0.2
217 0.19
218 0.15
219 0.14
220 0.15
221 0.17
222 0.16
223 0.11
224 0.14
225 0.15
226 0.16
227 0.17
228 0.17
229 0.17
230 0.17
231 0.16
232 0.12
233 0.13
234 0.14
235 0.15
236 0.17
237 0.17
238 0.17
239 0.18
240 0.18
241 0.2
242 0.21
243 0.2
244 0.18
245 0.18
246 0.19
247 0.18
248 0.18
249 0.15
250 0.12
251 0.1
252 0.09
253 0.09
254 0.08
255 0.08
256 0.08
257 0.1
258 0.1
259 0.1
260 0.1
261 0.1
262 0.14
263 0.15
264 0.18
265 0.2
266 0.22
267 0.23
268 0.29
269 0.31
270 0.29
271 0.29
272 0.28
273 0.27
274 0.23
275 0.24
276 0.22
277 0.2
278 0.19
279 0.18
280 0.21
281 0.24
282 0.25
283 0.26
284 0.26
285 0.3
286 0.33
287 0.42
288 0.49
289 0.54
290 0.62
291 0.69
292 0.74
293 0.79
294 0.86
295 0.86
296 0.87
297 0.87
298 0.88
299 0.88
300 0.88
301 0.82
302 0.73