Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F8CMX8

Protein Details
Accession A0A0F8CMX8    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
23-43DLRRFTTQIRQKMKRNRDRFPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR032549  DUF4939  
Pfam View protein in Pfam  
PF16297  DUF4939  
Amino Acid Sequences MTRTVQLSERLPDPDKFEGDRPDLRRFTTQIRQKMKRNRDRFPDAQDRMAYVNNRLKGPAYALILPYIQDGECLLPDYDAILKVLDRAYGDPDKVNRARSELFRLRQNNKEFATA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.35
3 0.34
4 0.36
5 0.36
6 0.38
7 0.43
8 0.43
9 0.47
10 0.45
11 0.45
12 0.45
13 0.42
14 0.44
15 0.46
16 0.5
17 0.51
18 0.59
19 0.63
20 0.68
21 0.76
22 0.8
23 0.81
24 0.8
25 0.79
26 0.78
27 0.79
28 0.74
29 0.72
30 0.71
31 0.63
32 0.59
33 0.51
34 0.43
35 0.36
36 0.35
37 0.27
38 0.22
39 0.25
40 0.23
41 0.23
42 0.22
43 0.21
44 0.18
45 0.19
46 0.16
47 0.13
48 0.12
49 0.12
50 0.13
51 0.12
52 0.12
53 0.1
54 0.08
55 0.06
56 0.05
57 0.05
58 0.05
59 0.05
60 0.07
61 0.07
62 0.06
63 0.06
64 0.07
65 0.08
66 0.08
67 0.08
68 0.06
69 0.06
70 0.08
71 0.08
72 0.08
73 0.08
74 0.09
75 0.14
76 0.17
77 0.18
78 0.2
79 0.22
80 0.29
81 0.31
82 0.35
83 0.31
84 0.33
85 0.37
86 0.38
87 0.46
88 0.46
89 0.48
90 0.53
91 0.6
92 0.62
93 0.66
94 0.68
95 0.66