Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F8B3T2

Protein Details
Accession A0A0F8B3T2    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MGKRKSSSKPQGPKKSDPLPTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, extr 6, nucl 3, cyto 3, cyto_nucl 3, vacu 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKSSSKPQGPKKSDPLPTTFLCLFCNHEDAVTVKINRRGGVGNLNCNICGQTFQCAINYLSAPVDVYSDWVDAAARKQQLDEIADDDDY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.82
3 0.79
4 0.72
5 0.66
6 0.6
7 0.53
8 0.51
9 0.43
10 0.35
11 0.29
12 0.26
13 0.25
14 0.21
15 0.23
16 0.17
17 0.15
18 0.15
19 0.15
20 0.17
21 0.17
22 0.16
23 0.17
24 0.22
25 0.23
26 0.22
27 0.23
28 0.2
29 0.18
30 0.25
31 0.24
32 0.24
33 0.25
34 0.24
35 0.23
36 0.22
37 0.21
38 0.12
39 0.12
40 0.09
41 0.1
42 0.12
43 0.12
44 0.13
45 0.14
46 0.15
47 0.15
48 0.15
49 0.12
50 0.1
51 0.1
52 0.1
53 0.08
54 0.08
55 0.06
56 0.08
57 0.08
58 0.08
59 0.08
60 0.08
61 0.08
62 0.08
63 0.11
64 0.15
65 0.16
66 0.17
67 0.17
68 0.2
69 0.23
70 0.25
71 0.24
72 0.21