Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F8AWC7

Protein Details
Accession A0A0F8AWC7    Localization Confidence High Confidence Score 23.1
NoLS Segment(s)
PositionSequenceProtein Nature
13-42AEKNTDFKKIKEKRRLKQLHKTKATKAVRPBasic
337-356GPNAKRIKKNEKYGFGGKKRBasic
385-410SAGGGKKRVSTQRPGKARRKAIASRRHydrophilic
NLS Segment(s)
PositionSequence
20-38KKIKEKRRLKQLHKTKATK
251-297AKKASAEARKLRELKKFGKKTQVAKIQERAKEKRETLDKIKNLKRKR
339-358NAKRIKKNEKYGFGGKKRHL
387-410GGGKKRVSTQRPGKARRKAIASRR
Subcellular Location(s) nucl 23, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008610  Ebp2  
Gene Ontology GO:0005730  C:nucleolus  
GO:0042254  P:ribosome biogenesis  
Pfam View protein in Pfam  
PF05890  Ebp2  
Amino Acid Sequences MVVKSKLKMALAAEKNTDFKKIKEKRRLKQLHKTKATKAVRPEESDEEWEDEEPESDSEQDEAANGINYEALNESDSDDSEVEMEEKIERVKKTAQTPATAPAKASKNDEDEDEDEDEDEEDIPMSDLEDLDDEDKEDLMPHTRLTIYNKDALITSLNRIIVPSDVSVPFVSHMCVVSSTPTASAITDVSDDVQREDAFLAQCLAAVKVARSKLVNDGVPFTRPTDYFAEMVKSDDHMEKIKDKMVAEASAKKASAEARKLRELKKFGKKTQVAKIQERAKEKRETLDKIKNLKRKRQENTNDVGTHEADEFDVAVDNELKTFRNKSEANGRFSGNGPNAKRIKKNEKYGFGGKKRHLKSSDSTSSGDLSGFSQKRNKAPFSSTSAGGGKKRVSTQRPGKARRKAIASRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.46
3 0.43
4 0.47
5 0.38
6 0.36
7 0.43
8 0.49
9 0.57
10 0.64
11 0.73
12 0.75
13 0.84
14 0.91
15 0.9
16 0.91
17 0.91
18 0.91
19 0.91
20 0.89
21 0.84
22 0.84
23 0.82
24 0.77
25 0.76
26 0.74
27 0.7
28 0.68
29 0.66
30 0.62
31 0.58
32 0.55
33 0.48
34 0.41
35 0.36
36 0.31
37 0.26
38 0.21
39 0.18
40 0.15
41 0.14
42 0.11
43 0.11
44 0.11
45 0.11
46 0.1
47 0.09
48 0.08
49 0.08
50 0.08
51 0.08
52 0.07
53 0.07
54 0.08
55 0.07
56 0.08
57 0.08
58 0.08
59 0.08
60 0.08
61 0.1
62 0.09
63 0.1
64 0.11
65 0.1
66 0.1
67 0.1
68 0.1
69 0.09
70 0.08
71 0.08
72 0.07
73 0.08
74 0.12
75 0.17
76 0.17
77 0.2
78 0.26
79 0.31
80 0.37
81 0.45
82 0.44
83 0.42
84 0.44
85 0.49
86 0.47
87 0.42
88 0.36
89 0.34
90 0.36
91 0.35
92 0.38
93 0.34
94 0.33
95 0.33
96 0.35
97 0.32
98 0.28
99 0.29
100 0.26
101 0.22
102 0.18
103 0.17
104 0.16
105 0.11
106 0.1
107 0.07
108 0.06
109 0.06
110 0.06
111 0.05
112 0.05
113 0.05
114 0.05
115 0.05
116 0.05
117 0.06
118 0.06
119 0.06
120 0.07
121 0.07
122 0.07
123 0.07
124 0.07
125 0.07
126 0.1
127 0.11
128 0.1
129 0.11
130 0.12
131 0.15
132 0.19
133 0.24
134 0.23
135 0.27
136 0.27
137 0.26
138 0.25
139 0.24
140 0.21
141 0.16
142 0.15
143 0.14
144 0.14
145 0.13
146 0.13
147 0.13
148 0.1
149 0.11
150 0.1
151 0.1
152 0.09
153 0.11
154 0.11
155 0.1
156 0.1
157 0.1
158 0.1
159 0.07
160 0.07
161 0.06
162 0.07
163 0.07
164 0.08
165 0.08
166 0.08
167 0.07
168 0.08
169 0.08
170 0.07
171 0.08
172 0.06
173 0.06
174 0.06
175 0.06
176 0.06
177 0.07
178 0.08
179 0.07
180 0.08
181 0.08
182 0.08
183 0.08
184 0.09
185 0.08
186 0.08
187 0.08
188 0.07
189 0.07
190 0.07
191 0.07
192 0.06
193 0.06
194 0.06
195 0.09
196 0.1
197 0.1
198 0.11
199 0.12
200 0.15
201 0.18
202 0.2
203 0.17
204 0.19
205 0.19
206 0.2
207 0.19
208 0.16
209 0.15
210 0.14
211 0.17
212 0.17
213 0.18
214 0.17
215 0.17
216 0.18
217 0.16
218 0.17
219 0.14
220 0.11
221 0.11
222 0.12
223 0.12
224 0.13
225 0.14
226 0.16
227 0.17
228 0.2
229 0.2
230 0.19
231 0.21
232 0.2
233 0.22
234 0.21
235 0.25
236 0.24
237 0.23
238 0.23
239 0.2
240 0.2
241 0.22
242 0.26
243 0.29
244 0.33
245 0.36
246 0.43
247 0.49
248 0.53
249 0.56
250 0.57
251 0.58
252 0.63
253 0.66
254 0.64
255 0.69
256 0.7
257 0.69
258 0.71
259 0.71
260 0.67
261 0.65
262 0.68
263 0.65
264 0.64
265 0.66
266 0.61
267 0.58
268 0.58
269 0.54
270 0.54
271 0.54
272 0.55
273 0.56
274 0.6
275 0.61
276 0.63
277 0.7
278 0.71
279 0.72
280 0.75
281 0.76
282 0.76
283 0.77
284 0.78
285 0.79
286 0.78
287 0.76
288 0.74
289 0.65
290 0.56
291 0.51
292 0.4
293 0.32
294 0.25
295 0.18
296 0.11
297 0.1
298 0.09
299 0.07
300 0.07
301 0.06
302 0.07
303 0.08
304 0.08
305 0.09
306 0.1
307 0.11
308 0.13
309 0.16
310 0.16
311 0.23
312 0.24
313 0.28
314 0.38
315 0.44
316 0.47
317 0.47
318 0.47
319 0.41
320 0.41
321 0.43
322 0.38
323 0.39
324 0.34
325 0.41
326 0.47
327 0.51
328 0.57
329 0.59
330 0.65
331 0.66
332 0.75
333 0.76
334 0.76
335 0.77
336 0.8
337 0.81
338 0.78
339 0.78
340 0.75
341 0.75
342 0.72
343 0.74
344 0.68
345 0.62
346 0.61
347 0.62
348 0.63
349 0.57
350 0.55
351 0.47
352 0.45
353 0.4
354 0.33
355 0.23
356 0.17
357 0.23
358 0.23
359 0.25
360 0.31
361 0.36
362 0.44
363 0.51
364 0.54
365 0.5
366 0.54
367 0.56
368 0.57
369 0.56
370 0.49
371 0.47
372 0.46
373 0.45
374 0.42
375 0.41
376 0.36
377 0.37
378 0.43
379 0.48
380 0.5
381 0.56
382 0.64
383 0.69
384 0.76
385 0.82
386 0.84
387 0.85
388 0.87
389 0.84
390 0.83