Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F8CMU2

Protein Details
Accession A0A0F8CMU2   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
58-82EEEEKKKKEEEKTKKKEKDKTEEDQAcidic
NLS Segment(s)
PositionSequence
63-76KKKKEEEKTKKKEK
Subcellular Location(s) cyto_nucl 10, nucl 9.5, cyto 9.5, mito 7
Family & Domain DBs
Amino Acid Sequences MHVYYTTYDKKDYLAYSFMKRQDETLGRAIWERGXGGGGGEGRGEGDEEDGDEKEEEGEEEEKKKKEEEKTKKKEKDKTEEDQSPLLFPFLHSLVFEFSSEMS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.27
3 0.31
4 0.37
5 0.4
6 0.39
7 0.37
8 0.35
9 0.38
10 0.38
11 0.36
12 0.35
13 0.31
14 0.28
15 0.29
16 0.28
17 0.2
18 0.17
19 0.12
20 0.08
21 0.07
22 0.06
23 0.06
24 0.06
25 0.05
26 0.05
27 0.05
28 0.05
29 0.04
30 0.05
31 0.04
32 0.04
33 0.04
34 0.04
35 0.05
36 0.05
37 0.06
38 0.06
39 0.06
40 0.05
41 0.05
42 0.05
43 0.06
44 0.07
45 0.08
46 0.12
47 0.17
48 0.18
49 0.19
50 0.22
51 0.26
52 0.34
53 0.44
54 0.52
55 0.59
56 0.68
57 0.78
58 0.85
59 0.87
60 0.87
61 0.86
62 0.85
63 0.81
64 0.79
65 0.78
66 0.75
67 0.69
68 0.64
69 0.55
70 0.46
71 0.39
72 0.31
73 0.21
74 0.15
75 0.16
76 0.13
77 0.13
78 0.11
79 0.12
80 0.14
81 0.15
82 0.15