Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F8B8I8

Protein Details
Accession A0A0F8B8I8   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
60-83TMKPEQRKAKAEKKAKKKSAPAKKBasic
NLS Segment(s)
PositionSequence
64-83EQRKAKAEKKAKKKSAPAKK
Subcellular Location(s) cyto 8, mito 7, E.R. 6, plas 3, extr 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAAAVRAGDTGSFGWFLSLGATPEAVAVLNDQPVIFTVLLIVLNVLIFQGGILWYIHHATMKPEQRKAKAEKKAKKKSAPAKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.08
4 0.08
5 0.08
6 0.08
7 0.08
8 0.08
9 0.07
10 0.07
11 0.07
12 0.06
13 0.05
14 0.05
15 0.06
16 0.06
17 0.06
18 0.06
19 0.06
20 0.06
21 0.08
22 0.07
23 0.06
24 0.06
25 0.06
26 0.06
27 0.06
28 0.05
29 0.03
30 0.03
31 0.03
32 0.03
33 0.02
34 0.02
35 0.02
36 0.02
37 0.02
38 0.03
39 0.03
40 0.04
41 0.05
42 0.06
43 0.06
44 0.07
45 0.07
46 0.1
47 0.19
48 0.28
49 0.33
50 0.4
51 0.47
52 0.52
53 0.6
54 0.66
55 0.67
56 0.68
57 0.73
58 0.75
59 0.8
60 0.85
61 0.87
62 0.87
63 0.88