Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F8D2L6

Protein Details
Accession A0A0F8D2L6    Localization Confidence High Confidence Score 22
NoLS Segment(s)
PositionSequenceProtein Nature
65-86APSKSRKAPEPEKKTRKPPPSTBasic
192-214EEERERARKAEKERRKREMIRRRBasic
NLS Segment(s)
PositionSequence
63-84SAAPSKSRKAPEPEKKTRKPPP
195-214RERARKAEKERRKREMIRRR
Subcellular Location(s) nucl 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR013256  Chromatin_SPT2  
Pfam View protein in Pfam  
PF08243  SPT2  
Amino Acid Sequences MGQVGKIQHKKVEKGLSKKERTEQMERLKSEQKATSAKKMAASRTSKVRGGTVTDVNNRKATSAAPSKSRKAPEPEKKTRKPPPSTGYTGTARPSAPSKLKKHTPGGALLETSSYSRSSSAARYEEEDEDMDGFIDDQEEEEDPEDNIRYGRRYVYDDYDSDGSSDMEVGLNEIDHEEAIAERIARQDDRLEEERERARKAEKERRKREMIRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.72
3 0.76
4 0.76
5 0.78
6 0.77
7 0.76
8 0.74
9 0.72
10 0.71
11 0.71
12 0.72
13 0.68
14 0.66
15 0.64
16 0.6
17 0.57
18 0.51
19 0.46
20 0.47
21 0.49
22 0.53
23 0.5
24 0.5
25 0.51
26 0.51
27 0.51
28 0.5
29 0.5
30 0.45
31 0.49
32 0.52
33 0.48
34 0.45
35 0.43
36 0.35
37 0.35
38 0.35
39 0.31
40 0.32
41 0.37
42 0.39
43 0.39
44 0.4
45 0.35
46 0.32
47 0.27
48 0.23
49 0.23
50 0.27
51 0.28
52 0.33
53 0.38
54 0.42
55 0.47
56 0.5
57 0.48
58 0.48
59 0.56
60 0.59
61 0.64
62 0.71
63 0.75
64 0.79
65 0.83
66 0.84
67 0.83
68 0.79
69 0.77
70 0.72
71 0.69
72 0.67
73 0.6
74 0.56
75 0.48
76 0.43
77 0.36
78 0.31
79 0.24
80 0.2
81 0.19
82 0.19
83 0.24
84 0.3
85 0.34
86 0.39
87 0.45
88 0.5
89 0.52
90 0.52
91 0.47
92 0.42
93 0.4
94 0.34
95 0.28
96 0.22
97 0.18
98 0.14
99 0.12
100 0.09
101 0.07
102 0.06
103 0.06
104 0.07
105 0.09
106 0.1
107 0.14
108 0.15
109 0.15
110 0.18
111 0.2
112 0.19
113 0.19
114 0.17
115 0.14
116 0.12
117 0.11
118 0.09
119 0.06
120 0.06
121 0.04
122 0.04
123 0.04
124 0.04
125 0.05
126 0.05
127 0.05
128 0.06
129 0.07
130 0.06
131 0.07
132 0.08
133 0.07
134 0.08
135 0.09
136 0.1
137 0.11
138 0.13
139 0.15
140 0.19
141 0.22
142 0.27
143 0.29
144 0.28
145 0.3
146 0.29
147 0.27
148 0.23
149 0.2
150 0.14
151 0.11
152 0.11
153 0.07
154 0.06
155 0.06
156 0.06
157 0.05
158 0.05
159 0.05
160 0.06
161 0.06
162 0.05
163 0.05
164 0.04
165 0.04
166 0.06
167 0.07
168 0.06
169 0.07
170 0.1
171 0.13
172 0.13
173 0.15
174 0.18
175 0.2
176 0.27
177 0.31
178 0.33
179 0.32
180 0.38
181 0.44
182 0.45
183 0.45
184 0.41
185 0.43
186 0.46
187 0.55
188 0.6
189 0.63
190 0.7
191 0.77
192 0.83
193 0.87
194 0.89