Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F8DCZ4

Protein Details
Accession A0A0F8DCZ4   
Localization Confidence Medium
Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
5-27SGHSSRRPRKFALRPPHKARSLNHydrophilic
NLS Segment(s)
PositionSequence
11-20RPRKFALRPP
Subcellular Location(s) nucl 16, mito_nucl 12.833, cyto_nucl 9.833, mito 8.5
Family & Domain DBs
Amino Acid Sequences MSSVSGHSSRRPRKFALRPPHKARSLNDDASVSDSINSDDQIFASGSSDTTSNMDDAVSVSVSMSNHNKTGMASGYHLDFLFDFVFLLEAAEPTAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.77
3 0.78
4 0.79
5 0.8
6 0.84
7 0.87
8 0.83
9 0.77
10 0.7
11 0.68
12 0.64
13 0.57
14 0.5
15 0.41
16 0.35
17 0.33
18 0.31
19 0.21
20 0.14
21 0.12
22 0.11
23 0.1
24 0.1
25 0.07
26 0.07
27 0.07
28 0.07
29 0.07
30 0.06
31 0.06
32 0.06
33 0.06
34 0.06
35 0.06
36 0.05
37 0.06
38 0.07
39 0.06
40 0.06
41 0.05
42 0.05
43 0.05
44 0.06
45 0.05
46 0.04
47 0.04
48 0.06
49 0.06
50 0.09
51 0.12
52 0.13
53 0.14
54 0.14
55 0.15
56 0.13
57 0.15
58 0.15
59 0.13
60 0.12
61 0.13
62 0.14
63 0.15
64 0.14
65 0.12
66 0.11
67 0.11
68 0.1
69 0.09
70 0.08
71 0.07
72 0.08
73 0.07
74 0.08
75 0.06
76 0.06