Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F8BL63

Protein Details
Accession A0A0F8BL63    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
73-93IEMLKRFGRRRKKLVNMMVLKHydrophilic
NLS Segment(s)
PositionSequence
80-84GRRRK
Subcellular Location(s) mito 9.5cyto_mito 9.5, cyto 8.5, nucl 8
Family & Domain DBs
Amino Acid Sequences MELSKRPKTSFNFSSLPTELRLYIIELLASNWASEHPSVKDIPLAPLASVNSEWQYVIERFTFSTVSADLGGIEMLKRFGRRRKKLVNMMVLKVTLPEYPNNPCESKETWKDKVKNNKVFRDTIIAMYTALSSWDEDEVKPGGFALTLKVWSASDFNQCSTELWQERLASHRDIGALRFNESYLDIAGFDDEGSRFIDIPYVYVVGYFSVDTNIPRVINPAAISEMVASLRLVRAVYLGVAKHTEGIHGTPANYKGKQAYDEPLAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.49
3 0.44
4 0.36
5 0.33
6 0.26
7 0.24
8 0.22
9 0.17
10 0.17
11 0.15
12 0.13
13 0.12
14 0.12
15 0.13
16 0.12
17 0.1
18 0.08
19 0.09
20 0.1
21 0.11
22 0.14
23 0.13
24 0.16
25 0.17
26 0.18
27 0.21
28 0.2
29 0.22
30 0.23
31 0.21
32 0.18
33 0.2
34 0.2
35 0.17
36 0.17
37 0.15
38 0.13
39 0.13
40 0.13
41 0.11
42 0.15
43 0.13
44 0.15
45 0.14
46 0.14
47 0.14
48 0.15
49 0.15
50 0.12
51 0.13
52 0.11
53 0.11
54 0.1
55 0.1
56 0.08
57 0.08
58 0.07
59 0.06
60 0.05
61 0.05
62 0.06
63 0.08
64 0.11
65 0.17
66 0.26
67 0.37
68 0.45
69 0.54
70 0.63
71 0.71
72 0.78
73 0.8
74 0.82
75 0.75
76 0.69
77 0.6
78 0.5
79 0.4
80 0.31
81 0.24
82 0.15
83 0.12
84 0.12
85 0.13
86 0.17
87 0.19
88 0.22
89 0.22
90 0.21
91 0.24
92 0.26
93 0.29
94 0.35
95 0.39
96 0.43
97 0.51
98 0.56
99 0.6
100 0.67
101 0.71
102 0.72
103 0.73
104 0.74
105 0.69
106 0.65
107 0.58
108 0.52
109 0.43
110 0.34
111 0.28
112 0.2
113 0.16
114 0.14
115 0.13
116 0.07
117 0.06
118 0.05
119 0.04
120 0.04
121 0.06
122 0.06
123 0.06
124 0.08
125 0.08
126 0.08
127 0.08
128 0.07
129 0.06
130 0.06
131 0.06
132 0.06
133 0.06
134 0.06
135 0.06
136 0.07
137 0.07
138 0.08
139 0.09
140 0.09
141 0.14
142 0.15
143 0.16
144 0.17
145 0.17
146 0.17
147 0.17
148 0.22
149 0.17
150 0.18
151 0.2
152 0.19
153 0.2
154 0.22
155 0.23
156 0.18
157 0.17
158 0.17
159 0.16
160 0.16
161 0.17
162 0.2
163 0.18
164 0.18
165 0.18
166 0.17
167 0.16
168 0.16
169 0.15
170 0.09
171 0.08
172 0.07
173 0.07
174 0.07
175 0.06
176 0.05
177 0.06
178 0.05
179 0.06
180 0.07
181 0.07
182 0.07
183 0.07
184 0.11
185 0.09
186 0.1
187 0.1
188 0.1
189 0.09
190 0.09
191 0.1
192 0.07
193 0.08
194 0.07
195 0.06
196 0.07
197 0.08
198 0.08
199 0.1
200 0.12
201 0.11
202 0.11
203 0.14
204 0.14
205 0.15
206 0.15
207 0.15
208 0.14
209 0.14
210 0.14
211 0.12
212 0.12
213 0.09
214 0.09
215 0.08
216 0.07
217 0.08
218 0.08
219 0.08
220 0.07
221 0.08
222 0.08
223 0.09
224 0.11
225 0.11
226 0.12
227 0.13
228 0.13
229 0.16
230 0.15
231 0.16
232 0.14
233 0.15
234 0.19
235 0.19
236 0.2
237 0.23
238 0.28
239 0.33
240 0.32
241 0.34
242 0.33
243 0.35
244 0.38
245 0.37
246 0.37