Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A7ELG6

Protein Details
Accession A7ELG6    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
51-70LGKAKIRRRKDNAIGINKQRHydrophilic
NLS Segment(s)
PositionSequence
56-59IRRR
Subcellular Location(s) cyto 16, cyto_nucl 12, mito 7, nucl 4
Family & Domain DBs
KEGG ssl:SS1G_06163  -  
Amino Acid Sequences MAAPTSITPTLACHISAEERIANVVHKDAEHSEAPAEKAARGVGYDVPELLGKAKIRRRKDNAIGINKQRVATDTEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.15
3 0.16
4 0.16
5 0.14
6 0.13
7 0.14
8 0.13
9 0.13
10 0.11
11 0.11
12 0.1
13 0.09
14 0.11
15 0.11
16 0.14
17 0.13
18 0.13
19 0.12
20 0.13
21 0.13
22 0.14
23 0.13
24 0.09
25 0.09
26 0.09
27 0.08
28 0.07
29 0.08
30 0.08
31 0.09
32 0.09
33 0.09
34 0.09
35 0.09
36 0.09
37 0.09
38 0.11
39 0.11
40 0.18
41 0.25
42 0.33
43 0.4
44 0.51
45 0.57
46 0.64
47 0.71
48 0.75
49 0.78
50 0.79
51 0.8
52 0.77
53 0.78
54 0.7
55 0.62
56 0.53
57 0.44