Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0F8CTK4

Protein Details
Accession A0A0F8CTK4    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
19-38AVPERPKTPKTPKTPKTPVTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto_nucl 12, cyto 7, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013960  DASH_Duo1  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0042729  C:DASH complex  
GO:0005874  C:microtubule  
GO:0072686  C:mitotic spindle  
GO:0051301  P:cell division  
GO:0007059  P:chromosome segregation  
GO:0000278  P:mitotic cell cycle  
Amino Acid Sequences MSDPIDDDSRDHIWTSPAAVPERPKTPKTPKTPKTPVTGSGLHGNQSAGYDRDTALRSELEGIKNINSVIESTIATLEKVRSNMNGATQDLADIEAEAILRQQAEQRRLLEEERRREALRQKAEDEERRVELAPVGAFQEGLRVELQPEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.2
3 0.19
4 0.21
5 0.23
6 0.25
7 0.29
8 0.32
9 0.4
10 0.42
11 0.41
12 0.46
13 0.54
14 0.61
15 0.66
16 0.72
17 0.72
18 0.77
19 0.84
20 0.8
21 0.77
22 0.71
23 0.64
24 0.58
25 0.53
26 0.44
27 0.41
28 0.37
29 0.3
30 0.27
31 0.24
32 0.18
33 0.17
34 0.16
35 0.1
36 0.1
37 0.1
38 0.1
39 0.13
40 0.14
41 0.13
42 0.13
43 0.12
44 0.11
45 0.14
46 0.16
47 0.14
48 0.14
49 0.15
50 0.13
51 0.14
52 0.14
53 0.1
54 0.07
55 0.07
56 0.06
57 0.07
58 0.06
59 0.06
60 0.07
61 0.07
62 0.07
63 0.07
64 0.08
65 0.08
66 0.09
67 0.1
68 0.09
69 0.12
70 0.12
71 0.15
72 0.15
73 0.14
74 0.14
75 0.13
76 0.12
77 0.1
78 0.1
79 0.07
80 0.05
81 0.04
82 0.04
83 0.04
84 0.04
85 0.04
86 0.04
87 0.04
88 0.04
89 0.09
90 0.15
91 0.18
92 0.22
93 0.24
94 0.26
95 0.29
96 0.32
97 0.36
98 0.38
99 0.43
100 0.45
101 0.47
102 0.46
103 0.49
104 0.54
105 0.55
106 0.56
107 0.52
108 0.49
109 0.54
110 0.6
111 0.63
112 0.6
113 0.55
114 0.48
115 0.45
116 0.43
117 0.36
118 0.29
119 0.24
120 0.19
121 0.15
122 0.14
123 0.12
124 0.12
125 0.11
126 0.14
127 0.12
128 0.13
129 0.12
130 0.12