Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0F8AZY2

Protein Details
Accession A0A0F8AZY2    Localization Confidence High Confidence Score 15.1
NoLS Segment(s)
PositionSequenceProtein Nature
7-45VDGNLPRAPPRRRSRPATRGPASKRQKRRFAIRERDELSHydrophilic
NLS Segment(s)
PositionSequence
13-37RAPPRRRSRPATRGPASKRQKRRFA
Subcellular Location(s) nucl 20, plas 4, mito 1, cyto 1, vacu 1, cyto_mito 1
Family & Domain DBs
Amino Acid Sequences MEQPGPVDGNLPRAPPRRRSRPATRGPASKRQKRRFAIRERDELSGPDSASDSESDSEEAIESNEGPGSGGGGAGNSAPPPANTLPPASTPSVQSSTTSTSTSRPTATPPPQTPPPPSGSSAYCGPPSCRKAPACCVCRLVTSWPSASSTGDTKHAVNYDQIDPARAVGTTASGNYTSQDHSRAPDKRSDFHSFFFQLLLVFILPPLTPANHYDNNH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.51
3 0.61
4 0.64
5 0.71
6 0.78
7 0.81
8 0.82
9 0.87
10 0.87
11 0.84
12 0.83
13 0.82
14 0.83
15 0.83
16 0.82
17 0.83
18 0.82
19 0.85
20 0.83
21 0.87
22 0.86
23 0.87
24 0.88
25 0.84
26 0.83
27 0.76
28 0.71
29 0.61
30 0.52
31 0.43
32 0.35
33 0.27
34 0.18
35 0.16
36 0.13
37 0.13
38 0.12
39 0.12
40 0.1
41 0.1
42 0.1
43 0.1
44 0.09
45 0.08
46 0.08
47 0.07
48 0.07
49 0.06
50 0.06
51 0.06
52 0.05
53 0.06
54 0.05
55 0.05
56 0.05
57 0.05
58 0.04
59 0.04
60 0.04
61 0.04
62 0.04
63 0.04
64 0.04
65 0.04
66 0.04
67 0.08
68 0.09
69 0.11
70 0.12
71 0.13
72 0.14
73 0.15
74 0.18
75 0.16
76 0.16
77 0.16
78 0.18
79 0.19
80 0.18
81 0.17
82 0.17
83 0.18
84 0.19
85 0.18
86 0.16
87 0.15
88 0.18
89 0.18
90 0.18
91 0.15
92 0.17
93 0.24
94 0.28
95 0.33
96 0.32
97 0.35
98 0.39
99 0.41
100 0.4
101 0.35
102 0.35
103 0.3
104 0.3
105 0.28
106 0.24
107 0.24
108 0.24
109 0.22
110 0.2
111 0.18
112 0.19
113 0.24
114 0.28
115 0.27
116 0.32
117 0.32
118 0.34
119 0.43
120 0.5
121 0.46
122 0.45
123 0.46
124 0.41
125 0.4
126 0.37
127 0.33
128 0.27
129 0.25
130 0.23
131 0.21
132 0.22
133 0.21
134 0.2
135 0.17
136 0.16
137 0.15
138 0.17
139 0.18
140 0.16
141 0.18
142 0.19
143 0.18
144 0.17
145 0.2
146 0.18
147 0.22
148 0.21
149 0.2
150 0.19
151 0.19
152 0.17
153 0.13
154 0.11
155 0.07
156 0.09
157 0.08
158 0.08
159 0.09
160 0.09
161 0.09
162 0.1
163 0.12
164 0.13
165 0.14
166 0.17
167 0.17
168 0.2
169 0.29
170 0.33
171 0.35
172 0.41
173 0.43
174 0.45
175 0.51
176 0.56
177 0.5
178 0.47
179 0.51
180 0.45
181 0.41
182 0.36
183 0.29
184 0.2
185 0.18
186 0.16
187 0.1
188 0.08
189 0.07
190 0.08
191 0.07
192 0.09
193 0.1
194 0.1
195 0.12
196 0.16
197 0.23