Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A7EDG1

Protein Details
Accession A7EDG1    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-49MVSAKKHVPIVKKRTKRFNRHQSDSYKCVDASWRKPKGIDNRVRRRFKGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16.5, mito_nucl 12.833, nucl 8, cyto_nucl 5.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG ssl:SS1G_03351  -  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVSAKKHVPIVKKRTKRFNRHQSDSYKCVDASWRKPKGIDNRVRRRFKGQMVMPSIGFGSNKKTRHMMPSGHKAFLVNNTSDVDLLLMHNKTFAAEISHAVSSRKRVEIVARAKALGVKVTNAKARVTTEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.88
3 0.89
4 0.9
5 0.9
6 0.9
7 0.88
8 0.87
9 0.85
10 0.82
11 0.75
12 0.68
13 0.59
14 0.48
15 0.41
16 0.41
17 0.4
18 0.43
19 0.48
20 0.5
21 0.49
22 0.5
23 0.57
24 0.59
25 0.62
26 0.61
27 0.62
28 0.68
29 0.77
30 0.82
31 0.77
32 0.73
33 0.69
34 0.65
35 0.63
36 0.56
37 0.54
38 0.53
39 0.52
40 0.44
41 0.38
42 0.32
43 0.24
44 0.19
45 0.12
46 0.13
47 0.18
48 0.19
49 0.21
50 0.23
51 0.24
52 0.29
53 0.32
54 0.32
55 0.33
56 0.42
57 0.43
58 0.41
59 0.4
60 0.35
61 0.31
62 0.31
63 0.27
64 0.17
65 0.16
66 0.16
67 0.16
68 0.16
69 0.15
70 0.09
71 0.07
72 0.07
73 0.09
74 0.08
75 0.08
76 0.09
77 0.08
78 0.09
79 0.09
80 0.09
81 0.08
82 0.09
83 0.11
84 0.13
85 0.14
86 0.14
87 0.15
88 0.17
89 0.19
90 0.22
91 0.23
92 0.21
93 0.22
94 0.28
95 0.36
96 0.41
97 0.44
98 0.41
99 0.39
100 0.39
101 0.39
102 0.34
103 0.29
104 0.23
105 0.19
106 0.23
107 0.28
108 0.33
109 0.33
110 0.33
111 0.31