Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A7ED48

Protein Details
Accession A7ED48    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
125-146KGEAARQKRLAKKKKNPATVTKHydrophilic
NLS Segment(s)
PositionSequence
128-140AARQKRLAKKKKN
Subcellular Location(s) mito 22.5, cyto_mito 13.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036788  T_IF-3_C_sf  
IPR001288  Translation_initiation_fac_3  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0043022  F:ribosome binding  
GO:0003743  F:translation initiation factor activity  
GO:0070124  P:mitochondrial translational initiation  
GO:0032790  P:ribosome disassembly  
KEGG ssl:SS1G_03237  -  
Amino Acid Sequences MSTTRCVFNAASALRRVFLAPIDHTSTPLLRPLTFSSHLTRIHASRTQQHRTLLKSTSHIVPEQRLPRDEEIKDLYVRLKNSEQRLDPPKATSEILKSINLKTHMLQIIAYSDDGEPPIAKIIDKGEAARQKRLAKKKKNPATVTKTIEMNWAIGKNDLSHRLQRIREFLEKGNKVEVVLAEKRKGRRASGEEAGEVIGKVREFVEGVEGARESRGMEGTVGTQAVLYFEGRVVGKKGKGEEGEGEGEKQDGEDEKQGEEGEGEKMEEEAENIAEEENFKLGAAN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.28
3 0.27
4 0.2
5 0.2
6 0.2
7 0.19
8 0.23
9 0.28
10 0.28
11 0.28
12 0.29
13 0.28
14 0.24
15 0.27
16 0.24
17 0.19
18 0.22
19 0.24
20 0.29
21 0.3
22 0.32
23 0.32
24 0.35
25 0.37
26 0.36
27 0.37
28 0.32
29 0.35
30 0.37
31 0.36
32 0.39
33 0.46
34 0.51
35 0.51
36 0.57
37 0.56
38 0.55
39 0.57
40 0.52
41 0.46
42 0.42
43 0.41
44 0.39
45 0.36
46 0.34
47 0.32
48 0.31
49 0.36
50 0.4
51 0.4
52 0.38
53 0.4
54 0.41
55 0.46
56 0.42
57 0.39
58 0.36
59 0.35
60 0.33
61 0.3
62 0.3
63 0.27
64 0.28
65 0.27
66 0.29
67 0.32
68 0.37
69 0.42
70 0.39
71 0.43
72 0.49
73 0.5
74 0.45
75 0.41
76 0.38
77 0.34
78 0.33
79 0.27
80 0.23
81 0.24
82 0.24
83 0.25
84 0.24
85 0.23
86 0.27
87 0.27
88 0.25
89 0.21
90 0.25
91 0.24
92 0.22
93 0.2
94 0.16
95 0.15
96 0.14
97 0.13
98 0.08
99 0.07
100 0.07
101 0.07
102 0.07
103 0.06
104 0.05
105 0.07
106 0.06
107 0.06
108 0.07
109 0.08
110 0.1
111 0.11
112 0.11
113 0.15
114 0.22
115 0.24
116 0.26
117 0.3
118 0.34
119 0.42
120 0.52
121 0.56
122 0.61
123 0.69
124 0.76
125 0.8
126 0.83
127 0.8
128 0.79
129 0.77
130 0.74
131 0.69
132 0.6
133 0.52
134 0.43
135 0.4
136 0.31
137 0.23
138 0.17
139 0.13
140 0.11
141 0.11
142 0.11
143 0.1
144 0.12
145 0.15
146 0.16
147 0.19
148 0.23
149 0.27
150 0.3
151 0.31
152 0.33
153 0.34
154 0.37
155 0.36
156 0.37
157 0.41
158 0.4
159 0.39
160 0.37
161 0.32
162 0.27
163 0.25
164 0.21
165 0.17
166 0.2
167 0.21
168 0.23
169 0.27
170 0.29
171 0.36
172 0.37
173 0.34
174 0.37
175 0.41
176 0.44
177 0.46
178 0.44
179 0.37
180 0.35
181 0.33
182 0.25
183 0.19
184 0.13
185 0.08
186 0.07
187 0.07
188 0.07
189 0.07
190 0.07
191 0.07
192 0.09
193 0.09
194 0.09
195 0.1
196 0.1
197 0.09
198 0.09
199 0.1
200 0.07
201 0.07
202 0.08
203 0.07
204 0.08
205 0.08
206 0.09
207 0.1
208 0.09
209 0.08
210 0.07
211 0.07
212 0.07
213 0.07
214 0.07
215 0.06
216 0.06
217 0.09
218 0.09
219 0.11
220 0.14
221 0.18
222 0.2
223 0.23
224 0.26
225 0.29
226 0.3
227 0.31
228 0.31
229 0.3
230 0.32
231 0.29
232 0.28
233 0.22
234 0.21
235 0.18
236 0.15
237 0.13
238 0.1
239 0.12
240 0.17
241 0.18
242 0.18
243 0.2
244 0.2
245 0.18
246 0.17
247 0.15
248 0.12
249 0.12
250 0.11
251 0.1
252 0.1
253 0.11
254 0.1
255 0.09
256 0.08
257 0.08
258 0.08
259 0.09
260 0.09
261 0.09
262 0.1
263 0.1
264 0.09
265 0.09