Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A7F1K1

Protein Details
Accession A7F1K1    Localization Confidence High Confidence Score 18.1
NoLS Segment(s)
PositionSequenceProtein Nature
231-257PRWKECVQRKHDWNKKHKKDMERFQEEBasic
NLS Segment(s)
PositionSequence
245-249KKHKK
259-287ARVGTKRKADGQPGGKNSKARRKELRAKA
Subcellular Location(s) nucl 22, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR028389  POT1  
IPR032042  POT1PC  
Gene Ontology GO:0000783  C:nuclear telomere cap complex  
GO:0098505  F:G-rich strand telomeric DNA binding  
GO:0010521  F:telomerase inhibitor activity  
GO:0051974  P:negative regulation of telomerase activity  
GO:0032210  P:regulation of telomere maintenance via telomerase  
GO:0016233  P:telomere capping  
KEGG ssl:SS1G_11471  -  
Pfam View protein in Pfam  
PF16686  POT1PC  
Amino Acid Sequences MENVQENDSVAAIPKSEMAIPSGFHTVEQIKNLDILPGGTVKKQFVNVIGFVMDYQPPIKLGGQEKADKAMNVRDKYSLLKDVKEGSFHDIIGEVRKIYGASYDMVTVYLTDYTAHPNFYNYILPELSDVTTEGRDGDDYGYIKAKPRDEAKEWKGPFGKMTIQLTLFDSHADFVKEKVKEGQWLRLTNVQFVVGKAGLLEGKLRGDRGSFEGKVQVEIMKQSEDPQSNDPRWKECVQRKHDWNKKHKKDMERFQEEIARVGTKRKADGQPGGKNSKARRKELRAKADAKTAVIETKVTKNLDLNDNVVLHPSRPYDGIVSLSTILQRTPLSSDPKYAGIHVPFENKNYKANVRVVDYFPENIADFAVGRKPSEYDLLSDYSGDEDDGPENNMQSFRDGEISEKKWKWRFALVVEDANPDASKDRATLIVGNRDAQLLFNDLNDACNLRRNPEMLNNVKEKLFTLWGDLEEQKIAMHAKEVQEKPQEEESPPEISKAADSESDDEEDVSKQTSGSLPPDDEETETLSYQKQNKIPKKSTTSMEIDLNLQRKEKNKKVEIQLEIKPRNKPFECCIKQYGIKVNEEDTEKADAGEGKRWQRVFGLWGTTIR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.13
4 0.13
5 0.14
6 0.15
7 0.15
8 0.17
9 0.2
10 0.18
11 0.17
12 0.2
13 0.22
14 0.24
15 0.27
16 0.25
17 0.22
18 0.25
19 0.25
20 0.22
21 0.17
22 0.15
23 0.13
24 0.16
25 0.17
26 0.18
27 0.21
28 0.22
29 0.24
30 0.26
31 0.27
32 0.27
33 0.3
34 0.27
35 0.26
36 0.24
37 0.21
38 0.19
39 0.19
40 0.15
41 0.12
42 0.12
43 0.11
44 0.11
45 0.13
46 0.15
47 0.18
48 0.22
49 0.27
50 0.32
51 0.37
52 0.37
53 0.4
54 0.4
55 0.35
56 0.34
57 0.36
58 0.39
59 0.37
60 0.38
61 0.35
62 0.35
63 0.39
64 0.41
65 0.41
66 0.35
67 0.34
68 0.35
69 0.4
70 0.4
71 0.38
72 0.35
73 0.32
74 0.31
75 0.28
76 0.26
77 0.2
78 0.2
79 0.21
80 0.21
81 0.15
82 0.13
83 0.14
84 0.14
85 0.12
86 0.13
87 0.1
88 0.1
89 0.11
90 0.12
91 0.11
92 0.11
93 0.11
94 0.09
95 0.09
96 0.08
97 0.07
98 0.07
99 0.08
100 0.14
101 0.15
102 0.17
103 0.16
104 0.17
105 0.18
106 0.19
107 0.22
108 0.17
109 0.19
110 0.17
111 0.17
112 0.16
113 0.16
114 0.15
115 0.12
116 0.11
117 0.1
118 0.1
119 0.1
120 0.09
121 0.08
122 0.08
123 0.09
124 0.09
125 0.11
126 0.11
127 0.13
128 0.15
129 0.16
130 0.21
131 0.25
132 0.26
133 0.28
134 0.34
135 0.4
136 0.43
137 0.53
138 0.53
139 0.58
140 0.57
141 0.59
142 0.56
143 0.49
144 0.44
145 0.37
146 0.36
147 0.31
148 0.33
149 0.29
150 0.26
151 0.26
152 0.27
153 0.25
154 0.2
155 0.15
156 0.13
157 0.11
158 0.12
159 0.12
160 0.1
161 0.11
162 0.18
163 0.18
164 0.19
165 0.24
166 0.24
167 0.3
168 0.32
169 0.39
170 0.38
171 0.4
172 0.41
173 0.42
174 0.41
175 0.35
176 0.33
177 0.27
178 0.21
179 0.19
180 0.19
181 0.13
182 0.12
183 0.1
184 0.1
185 0.08
186 0.08
187 0.08
188 0.06
189 0.09
190 0.09
191 0.1
192 0.1
193 0.1
194 0.12
195 0.15
196 0.2
197 0.18
198 0.18
199 0.23
200 0.22
201 0.23
202 0.22
203 0.19
204 0.14
205 0.15
206 0.15
207 0.12
208 0.11
209 0.14
210 0.19
211 0.2
212 0.21
213 0.25
214 0.31
215 0.33
216 0.39
217 0.38
218 0.35
219 0.38
220 0.39
221 0.42
222 0.44
223 0.51
224 0.52
225 0.6
226 0.66
227 0.72
228 0.76
229 0.76
230 0.79
231 0.81
232 0.82
233 0.84
234 0.81
235 0.81
236 0.83
237 0.84
238 0.83
239 0.79
240 0.71
241 0.62
242 0.6
243 0.5
244 0.42
245 0.33
246 0.23
247 0.17
248 0.19
249 0.21
250 0.17
251 0.19
252 0.24
253 0.27
254 0.3
255 0.36
256 0.41
257 0.44
258 0.48
259 0.5
260 0.45
261 0.46
262 0.48
263 0.5
264 0.48
265 0.48
266 0.51
267 0.57
268 0.66
269 0.71
270 0.74
271 0.72
272 0.7
273 0.65
274 0.63
275 0.54
276 0.43
277 0.35
278 0.26
279 0.19
280 0.15
281 0.14
282 0.1
283 0.13
284 0.16
285 0.15
286 0.15
287 0.16
288 0.18
289 0.21
290 0.2
291 0.18
292 0.16
293 0.16
294 0.16
295 0.15
296 0.13
297 0.1
298 0.1
299 0.1
300 0.09
301 0.09
302 0.1
303 0.09
304 0.1
305 0.11
306 0.09
307 0.1
308 0.09
309 0.09
310 0.09
311 0.08
312 0.08
313 0.07
314 0.07
315 0.07
316 0.09
317 0.13
318 0.18
319 0.19
320 0.21
321 0.21
322 0.24
323 0.23
324 0.22
325 0.21
326 0.17
327 0.19
328 0.18
329 0.22
330 0.2
331 0.23
332 0.26
333 0.24
334 0.26
335 0.26
336 0.27
337 0.26
338 0.29
339 0.29
340 0.28
341 0.3
342 0.28
343 0.27
344 0.27
345 0.22
346 0.19
347 0.17
348 0.13
349 0.1
350 0.09
351 0.07
352 0.06
353 0.06
354 0.1
355 0.09
356 0.09
357 0.09
358 0.1
359 0.11
360 0.15
361 0.14
362 0.12
363 0.15
364 0.16
365 0.16
366 0.15
367 0.14
368 0.11
369 0.1
370 0.09
371 0.06
372 0.05
373 0.06
374 0.07
375 0.08
376 0.08
377 0.08
378 0.09
379 0.1
380 0.09
381 0.1
382 0.1
383 0.09
384 0.12
385 0.11
386 0.14
387 0.2
388 0.24
389 0.31
390 0.33
391 0.4
392 0.43
393 0.46
394 0.46
395 0.45
396 0.45
397 0.39
398 0.46
399 0.41
400 0.39
401 0.37
402 0.35
403 0.29
404 0.26
405 0.22
406 0.14
407 0.12
408 0.09
409 0.09
410 0.08
411 0.09
412 0.09
413 0.11
414 0.15
415 0.17
416 0.24
417 0.24
418 0.25
419 0.24
420 0.23
421 0.22
422 0.18
423 0.16
424 0.11
425 0.11
426 0.09
427 0.11
428 0.11
429 0.11
430 0.11
431 0.12
432 0.1
433 0.17
434 0.17
435 0.18
436 0.2
437 0.21
438 0.24
439 0.3
440 0.38
441 0.37
442 0.42
443 0.43
444 0.42
445 0.42
446 0.39
447 0.32
448 0.26
449 0.23
450 0.18
451 0.18
452 0.18
453 0.18
454 0.21
455 0.21
456 0.19
457 0.16
458 0.16
459 0.12
460 0.12
461 0.12
462 0.09
463 0.1
464 0.13
465 0.17
466 0.26
467 0.28
468 0.33
469 0.39
470 0.4
471 0.43
472 0.46
473 0.45
474 0.37
475 0.41
476 0.37
477 0.35
478 0.34
479 0.3
480 0.24
481 0.21
482 0.21
483 0.17
484 0.16
485 0.12
486 0.14
487 0.16
488 0.17
489 0.18
490 0.18
491 0.17
492 0.16
493 0.15
494 0.14
495 0.12
496 0.11
497 0.09
498 0.1
499 0.12
500 0.14
501 0.17
502 0.19
503 0.19
504 0.19
505 0.22
506 0.22
507 0.21
508 0.2
509 0.19
510 0.18
511 0.17
512 0.18
513 0.17
514 0.22
515 0.27
516 0.33
517 0.35
518 0.44
519 0.53
520 0.62
521 0.68
522 0.71
523 0.74
524 0.73
525 0.72
526 0.68
527 0.65
528 0.58
529 0.54
530 0.45
531 0.41
532 0.4
533 0.41
534 0.36
535 0.33
536 0.33
537 0.38
538 0.48
539 0.52
540 0.57
541 0.6
542 0.67
543 0.74
544 0.79
545 0.78
546 0.75
547 0.74
548 0.74
549 0.74
550 0.7
551 0.68
552 0.64
553 0.67
554 0.64
555 0.62
556 0.59
557 0.62
558 0.63
559 0.61
560 0.62
561 0.59
562 0.6
563 0.61
564 0.63
565 0.57
566 0.55
567 0.51
568 0.48
569 0.45
570 0.44
571 0.39
572 0.32
573 0.31
574 0.27
575 0.25
576 0.24
577 0.24
578 0.23
579 0.29
580 0.34
581 0.35
582 0.42
583 0.43
584 0.42
585 0.4
586 0.41
587 0.39
588 0.37
589 0.37