Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A7F5P8

Protein Details
Accession A7F5P8    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
63-86ELLRNSKDKRARKLAKKRLGTFGRBasic
NLS Segment(s)
PositionSequence
68-89SKDKRARKLAKKRLGTFGRAKA
Subcellular Location(s) nucl 12, mito 10, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038097  L36e_sf  
IPR000509  Ribosomal_L36e  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0002181  P:cytoplasmic translation  
KEGG ssl:SS1G_12926  -  
Pfam View protein in Pfam  
PF01158  Ribosomal_L36e  
PROSITE View protein in PROSITE  
PS01190  RIBOSOMAL_L36E  
Amino Acid Sequences MAAEKQPRTGLAVGLNKGHKTETRVSKPKVSRTKGHLSKRTAFVRDIVKEVSGLAPYERRVIELLRNSKDKRARKLAKKRLGTFGRAKAKVDELQGVIAESRRAGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.35
3 0.32
4 0.31
5 0.32
6 0.26
7 0.26
8 0.34
9 0.39
10 0.46
11 0.55
12 0.58
13 0.65
14 0.68
15 0.73
16 0.74
17 0.69
18 0.65
19 0.64
20 0.71
21 0.71
22 0.74
23 0.72
24 0.68
25 0.69
26 0.69
27 0.67
28 0.58
29 0.5
30 0.44
31 0.42
32 0.37
33 0.33
34 0.26
35 0.21
36 0.19
37 0.18
38 0.15
39 0.09
40 0.08
41 0.06
42 0.07
43 0.08
44 0.11
45 0.1
46 0.1
47 0.11
48 0.12
49 0.16
50 0.22
51 0.28
52 0.3
53 0.36
54 0.36
55 0.43
56 0.5
57 0.52
58 0.53
59 0.58
60 0.64
61 0.69
62 0.79
63 0.83
64 0.84
65 0.86
66 0.82
67 0.81
68 0.76
69 0.72
70 0.68
71 0.67
72 0.67
73 0.6
74 0.57
75 0.5
76 0.5
77 0.47
78 0.42
79 0.36
80 0.27
81 0.27
82 0.25
83 0.23
84 0.19
85 0.17
86 0.15